Property Summary

NCBI Gene PubMed Count 21
PubMed Score 3.27
PubTator Score 25.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 1.9e-04
hereditary spastic paraplegia -1.287 1.4e-03
medulloblastoma, large-cell -1.300 1.0e-04
Multiple myeloma 1.557 1.7e-03
ovarian cancer -1.500 7.8e-04

 GO Function (1)

AA Sequence

MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLDQFTPVKIEGY      1 - 70
EDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGV     71 - 140
CTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFTITPSTTQVVGILKIQVHYYEDGNVQLVSHK    141 - 210
DIQDSLTVSNEVQTAKEFIKIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG    211 - 280
KEMQNA                                                                    281 - 286
//

Text Mined References (31)

PMID Year Title