Property Summary

NCBI Gene PubMed Count 55
Grant Count 62
R01 Count 32
Funding $3,920,798.25
PubMed Score 65.36
PubTator Score 57.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P47736 J3QSS6 O75062 Q5T3S9 Q5T3T4 Q7Z5S8 Q9UQ51 Rap1GAP
Symbols RAPGAP
RAP1GA1
RAP1GAP1
RAP1GAPII

Gene

PANTHER Protein Class (2)

PDB

3BRW   1SRQ  

Gene RIF (30)

PMID Text
25329897 Rap1GAP is ubiquitinated and degraded through proteasome pathway in mitosis. Rap1GAP interacts with PLK1 in vivo.
24642466 kidney biopsies from glomerulosclerosis patients exhibited increased RAP1GAP, resulting in diminished glomerular RAP1 activation
23864657 findings identify Rap1GAP as a critical regulator of aggressive tumor cell behavior and suggest that the level of Rap1GAP expression influences the migratory mechanisms that are operative in tumor cells.
22696507 Downregulation of RAP1GAP in thyroid tumors enhances SRC-dependent signals that regulate cellular architecture and motility.
22614916 Results demonstrated that Rap1GAP promoted leukemia cell differentiation and apoptosis, but increased leukemia cell invasion in vitro.
22266190 Over-expression of Rap1GAP attenuated levels of both cadherins and integrins that are known to regulate the cancer cells invasion in renal cel carcinoma.
21832044 Human kidney cells evidence increased EP4 and decreased Rap1GAP expression levels in the malignant compared with benign samples.
21785277 Rap1GAP is a more effective inhibitor of cell-matrix adhesion compared to cell-cell adhesion.
21633110 These studies establish that the direct physical interaction of Rap1 with KRIT1 enables the translocation of microtubule-sequestered KRIT1 to junctions, thereby supporting junctional integrity and cardiovascular development
21532618 A polycomb-mediated repression of rap1GAP was demonstrated that involves EZH2, a histone methyltransferase in head and neck cancers. It was also shown that the loss of miR-101 expression correlates with EZH2 upregulation and rap1GAP downregulation.
More...

AA Sequence

MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTNHEITSIPETE      1 - 70
PLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHD     71 - 140
VIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEEL    141 - 210
FSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQ    211 - 280
QLQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLP    281 - 350
DPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN    351 - 420
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIVPGKSPTRKKS    421 - 490
GPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAE    491 - 560
ALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSR    561 - 630
SPHPDAGKLGDPACPEIKIQLEASEQHMPQLGC                                         631 - 663
//

Text Mined References (64)

PMID Year Title
25329897 2014 PLK1 and ?-TrCP-dependent ubiquitination and degradation of Rap1GAP controls cell proliferation.
24642466 2014 Podocyte-specific RAP1GAP expression contributes to focal segmental glomerulosclerosis-associated glomerular injury.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23864657 2013 Tumor cell migration and invasion are enhanced by depletion of Rap1 GTPase-activating protein (Rap1GAP).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22696507 2012 RAP1GAP inhibits cytoskeletal remodeling and motility in thyroid cancer cells.
22614916 2012 Rap1GAP alters leukemia cell differentiation, apoptosis and invasion in vitro.
22266190 2012 Rap1GAP regulates renal cell carcinoma invasion.
21832044 2011 Prostaglandin E2 regulates renal cell carcinoma invasion through the EP4 receptor-Rap GTPase signal transduction pathway.
More...