Property Summary

NCBI Gene PubMed Count 58
PubMed Score 64.95
PubTator Score 57.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -1.082 2.0e-02
adult high grade glioma -1.600 7.6e-05
astrocytic glioma -1.300 2.1e-02
Astrocytoma, Pilocytic -1.100 1.5e-04
atypical teratoid / rhabdoid tumor -2.500 6.1e-10
ductal carcinoma in situ 1.500 1.9e-02
ependymoma -1.700 2.3e-02
glioblastoma -1.600 7.1e-07
group 3 medulloblastoma -1.400 5.3e-04
interstitial cystitis -1.200 1.5e-03
invasive ductal carcinoma 2.100 7.7e-03
lung cancer -2.100 9.0e-04
medulloblastoma, large-cell -2.300 2.2e-05
oligodendroglioma -1.700 2.6e-20
ovarian cancer 1.100 1.2e-04
pancreatic cancer -1.100 3.9e-03
Pick disease -1.800 1.8e-03
primary pancreatic ductal adenocarcinoma -1.195 3.4e-03
primitive neuroectodermal tumor -1.400 1.8e-02

Gene RIF (32)

AA Sequence

MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTNHEITSIPETE      1 - 70
PLQSPTTKVKLECNPTARIYRKHFLGKEHFNYYSLDAALGHLVFSLKYDVIGDQEHLRLLLRTKCRTYHD     71 - 140
VIPISCLTEFPNVVQMAKLVCEDVNVDRFYPVLYPKASRLIVTFDEHVISNNFKFGVIYQKLGQTSEEEL    141 - 210
FSTNEESPAFVEFLEFLGQKVKLQDFKGFRGGLDVTHGQTGTESVYCNFRNKEIMFHVSTKLPYTEGDAQ    211 - 280
QLQRKRHIGNDIVAVVFQDENTPFVPDMIASNFLHAYVVVQAEGGGPDGPLYKVSVTARDDVPFFGPPLP    281 - 350
DPAVFRKGPEFQEFLLTKLINAEYACYKAEKFAKLEERTRAALLETLYEELHIHSQSMMGLGGDEDKMEN    351 - 420
GSGGGGFFESFKRVIRSRSQSMDAMGLSNKKPNTVSTSHSGSFAPNNPDLAKAAGISLIVPGKSPTRKKS    421 - 490
GPFGSRRSSAIGIENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRAETAAQRAE    491 - 560
ALKDFSRSSSSASSFASVVEETEGVDGEDTGLESVSSSGTPHKRDSFIYSTWLEDSVSTTSGGSSPGPSR    561 - 630
SPHPDAGKLGDPACPEIKIQLEASEQHMPQLGC                                         631 - 663
//

Text Mined References (67)

PMID Year Title