Property Summary

Ligand Count 160
NCBI Gene PubMed Count 179
PubMed Score 506.68
PubTator Score 587.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
lung cancer 4740 0.0 0.5
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 0.7
Osteoarthritis 184 0.0 1.2

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease -2.292 3.4e-02
adrenocortical adenoma -2.614 1.3e-06
adrenocortical carcinoma -3.562 3.4e-07
atypical teratoid / rhabdoid tumor -2.400 1.6e-05
Breast cancer -2.600 1.1e-11
breast carcinoma -1.200 8.2e-05
colon cancer -1.200 7.1e-03
cystic fibrosis 2.198 9.1e-06
ductal carcinoma in situ -1.900 9.2e-05
ependymoma 1.200 4.3e-03
glioblastoma 1.300 9.7e-03
group 4 medulloblastoma -1.800 5.0e-03
interstitial cystitis -1.400 1.2e-03
invasive ductal carcinoma -1.600 1.7e-02
lung adenocarcinoma 1.378 1.3e-02
malignant mesothelioma -8.400 2.3e-10
medulloblastoma, large-cell -2.300 8.3e-04
nasopharyngeal carcinoma 1.100 4.7e-02
ovarian cancer -3.200 2.8e-06
pancreatic cancer 1.100 2.8e-03
pancreatic carcinoma 1.100 2.8e-03
pediatric high grade glioma 1.100 2.9e-02
tuberculosis and treatment for 3 months -1.100 2.9e-02

Gene RIF (152)

AA Sequence

MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPV      1 - 70
WNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMSLEVCS     71 - 140
CPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEGLHSARDVPVVAILGSGGGFRAMVGFSGVMK    141 - 210
ALYESGILDCATYVAGLSGSTWYMSTLYSHPDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLW    211 - 280
KKKSSGQPVTFTDIFGMLIGETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFS    281 - 350
PYEIGMAKYGTFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE    351 - 420
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFNTREGRAGKVH    421 - 490
NFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDVKSKKIHVVDSGLTFNLPYPL    491 - 560
ILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKIDPYVFDREGLKECYVFKPKNPDM    561 - 630
EKDCPTIIHFVLANINFRKYRAPGVPRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFN    631 - 700
TLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSKPKA                         701 - 749
//

Text Mined References (188)

PMID Year Title