Property Summary

NCBI Gene PubMed Count 172
Grant Count 299
R01 Count 194
Funding $35,945,599.1
PubMed Score 492.29
PubTator Score 587.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession P47712 B1AKG4 Q29R80 cPLA2
Symbols cPLA2
PLA2G4
cPLA2-alpha

Gene

PANTHER Protein Class (3)

PDB

1BCI   1CJY   1RLW  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ

Gene RIF (146)

PMID Text
26525102 genetic association study in Quebec City population: Data suggest total plasma n-6 fatty acid phospholipid levels and C-reactive protein are modulated by SNPs in PLA2G4A and PLA2G6 alone or in combination with fish oil dietary supplementation.
26416244 cPLA2alpha plays an important role in cell cycle re-entry by quiescent prostate cancer cells
26303530 The study reports the formation of a multiprotein complex at the G2-to-M transition in vitro and in vivo. Group IVA cytosolic phospholipase A2 (cPLA2-alpha) acts as a bridge in this complex to promote binding of SIRT2 to cyclin A-Cdk2.
26183771 These studies constitute a definitive account, demonstrating the fundamental role of cPLA2alpha to eicosanoid formation and cellular responses within the human circulation.
25969996 Thymocyte maturation can occur independently of cPLA2-alpha.
25904158 Letter: report instability of cytosolic phospholipase A2alpha variant resulting in severe impairment in platelet arachidonic acid metabolism.
25761116 alphaSN triggered synapse damage via hyperactivation of cPLA2
25617738 Suggest retinal pigment epithelium metabolism of 7-ketocholesterol occurs by esterification to fatty acids via cPLA2alpha and SOAT1 followed by selective efflux to HDL.
25365190 We conclude that cPLA2alpha is required for sustaining AKT phosphorylation at Ser473 and cell proliferation in colorectal cancer cells with PI3K mutation
25102815 Case Report/Twin Study: syndromic form of deficiency of cPLA2a , characterised by recurrent GI ulcers and bleeding diathesis, associated with mild inherited deficiency of factor XI.
More...

AA Sequence

MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPV      1 - 70
WNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEVPFIFNQVTEMVLEMSLEVCS     71 - 140
CPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEGLHSARDVPVVAILGSGGGFRAMVGFSGVMK    141 - 210
ALYESGILDCATYVAGLSGSTWYMSTLYSHPDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLW    211 - 280
KKKSSGQPVTFTDIFGMLIGETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFS    281 - 350
PYEIGMAKYGTFMAPDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE    351 - 420
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFNTREGRAGKVH    421 - 490
NFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDVKSKKIHVVDSGLTFNLPYPL    491 - 560
ILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKIDPYVFDREGLKECYVFKPKNPDM    561 - 630
EKDCPTIIHFVLANINFRKYRAPGVPRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFN    631 - 700
TLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARRFFNKEFLSKPKA                         701 - 749
//

Text Mined References (180)

PMID Year Title
26525102 2015 Modulation of C-reactive protein and plasma omega-6 fatty acid levels by phospholipase A2 gene polymorphisms following a 6-week supplementation with fish oil.
26416244 2015 Targeting of cytosolic phospholipase A2? impedes cell cycle re-entry of quiescent prostate cancer cells.
26303530 2015 Group IVA Cytosolic Phospholipase A2 Regulates the G2-to-M Transition by Modulating the Activity of Tumor Suppressor SIRT2.
26183771 2015 Inherited human group IVA cytosolic phospholipase A2 deficiency abolishes platelet, endothelial, and leucocyte eicosanoid generation.
25969996 2015 Study of the role of cytosolic phospholipase A2 alpha in eicosanoid generation and thymocyte maturation in the thymus.
25904158 2015 Instability of cytosolic phospholipase A2? variant upon cellular expression as a basis for its clinical presentation.
25761116 2015 ?-Synuclein-induced synapse damage in cultured neurons is mediated by cholesterol-sensitive activation of cytoplasmic phospholipase A2.
25617738 2015 Extra-hepatic metabolism of 7-ketocholesterol occurs by esterification to fatty acids via cPLA2? and SOAT1 followed by selective efflux to HDL.
25365190 2014 Targeting cytosolic phospholipase A2 ? in colorectal cancer cells inhibits constitutively activated protein kinase B (AKT) and cell proliferation.
25102815 2014 Bleeding diathesis and gastro-duodenal ulcers in inherited cytosolic phospholipase-A2 alpha deficiency.
More...