Property Summary

NCBI Gene PubMed Count 16
Grant Count 61
R01 Count 7
Funding $25,414,045
PubMed Score 779.69
PubTator Score 603.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.200 0.001
non-inflammatory breast cancer -2.500 0.021
ductal carcinoma in situ -2.200 0.004
invasive ductal carcinoma -2.500 0.004
psoriasis -1.300 0.000

Gene RIF (3)

PMID Text
21361910 Results suggest that autoimmunity to insulin can occur infrequently via cross-reactivity to food protein alpha casein.
21135174 Casein alpha s1 is expressed in human monocytes and stimulates expression of proinflammatory cytokine granulocyte-macrophage colony-stimulating factor (GM-CSF) via an immunomodulatory role beyond the nutritional function of CSN1S1 in milk.
16683014 alphas1-Casein may be a potential biomarker for early identification of BPH patients.

AA Sequence

MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQTDEIKDTRNE      1 - 70
STQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLN     71 - 140
QLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW                             141 - 185
//

Text Mined References (23)

PMID Year Title
21361910 2011 Insulin autoantibodies with high affinity to the bovine milk protein alpha casein.
21135174 2011 Casein ? s1 is expressed by human monocytes and upregulates the production of GM-CSF via p38 MAPK.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18847231 2008 Analysis of the human casein phosphoproteome by 2-D electrophoresis and MALDI-TOF/TOF MS reveals new phosphoforms.
17646876 2007 On studying protein phosphorylation patterns using bottom-up LC-MS/MS: the case of human alpha-casein.
16683014 2006 Evidence of a novel biomarker, alphas1-Casein, a milk protein, in benign prostate hyperplasia.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12919330 2003 The phosphorylation pattern of human alphas1-casein is markedly different from the ruminant species.
More...