Property Summary

NCBI Gene PubMed Count 16
PubMed Score 850.94
PubTator Score 603.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.500 3.6e-12
ductal carcinoma in situ -2.200 3.9e-03
invasive ductal carcinoma -2.500 4.3e-03
malignant mesothelioma -1.200 6.1e-04
psoriasis -1.300 1.1e-04

Gene RIF (3)

AA Sequence

MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQTDEIKDTRNE      1 - 70
STQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLN     71 - 140
QLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW                             141 - 185
//

Text Mined References (23)

PMID Year Title