Property Summary

NCBI Gene PubMed Count 16
PubMed Score 779.69
PubTator Score 603.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -1.200 0.001
non-inflammatory breast cancer -2.500 0.021
ductal carcinoma in situ -2.200 0.004
invasive ductal carcinoma -2.500 0.004
psoriasis -1.300 0.000

Synonym

Accession P47710 A1A510 A1A511 E9PB60 Q4PNR5
Symbols CASA
CSN1

Gene

PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
21361910 Results suggest that autoimmunity to insulin can occur infrequently via cross-reactivity to food protein alpha casein.
21135174 Casein alpha s1 is expressed in human monocytes and stimulates expression of proinflammatory cytokine granulocyte-macrophage colony-stimulating factor (GM-CSF) via an immunomodulatory role beyond the nutritional function of CSN1S1 in milk.
16683014 alphas1-Casein may be a potential biomarker for early identification of BPH patients.

AA Sequence

MRLLILTCLVAVALARPKLPLRYPERLQNPSESSEPIPLESREEYMNGMNRQRNILREKQTDEIKDTRNE      1 - 70
STQNCVVAEPEKMESSISSSSEEMSLSKCAEQFCRLNEYNQLQLQAAHAQEQIRRMNENSHVQVPFQQLN     71 - 140
QLAAYPYAVWYYPQIMQYVPFPPFSDISNPTAHENYEKNNVMLQW                             141 - 185
//

Text Mined References (23)

PMID Year Title
21361910 2011 Insulin autoantibodies with high affinity to the bovine milk protein alpha casein.
21135174 2011 Casein ? s1 is expressed by human monocytes and upregulates the production of GM-CSF via p38 MAPK.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18847231 2008 Analysis of the human casein phosphoproteome by 2-D electrophoresis and MALDI-TOF/TOF MS reveals new phosphoforms.
17646876 2007 On studying protein phosphorylation patterns using bottom-up LC-MS/MS: the case of human alpha-casein.
16683014 2006 Evidence of a novel biomarker, alphas1-Casein, a milk protein, in benign prostate hyperplasia.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12919330 2003 The phosphorylation pattern of human alphas1-casein is markedly different from the ruminant species.
More...