Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.57
PubTator Score 18.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 0.015
ependymoma -1.300 0.003
oligodendroglioma -1.100 0.005
psoriasis 1.700 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.200 0.003
lung cancer 1.700 0.002
Breast cancer 1.200 0.000
ductal carcinoma in situ 1.100 0.007
invasive ductal carcinoma 1.600 0.000

Gene RIF (3)

PMID Text
22495352 The expression levels of cellular Mss4 mRNA and protein are rapidly changed in response to a broad range of extracellular stress stimuli.
19536175 Observational study of gene-disease association. (HuGE Navigator)
12105226 MSS4 modulates Rab15 activity in early endocytosis

AA Sequence

MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWL      1 - 70
VEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE                      71 - 123
//

Text Mined References (21)

PMID Year Title
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
25416956 2014 A proteome-scale map of the human interactome network.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22495352 2012 Mss4 protein is a regulator of stress response and apoptosis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
16541104 2006 Nucleotide exchange via local protein unfolding--structure of Rab8 in complex with MSS4.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...