Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.13
PubTator Score 18.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 1.5e-02
atypical teratoid / rhabdoid tumor -1.100 4.0e-05
Breast cancer 1.200 5.4e-18
ductal carcinoma in situ 1.100 7.0e-03
ependymoma -1.300 3.0e-03
invasive ductal carcinoma 1.300 3.1e-04
lung cancer 1.700 2.1e-03
medulloblastoma, large-cell -1.200 3.1e-03
oligodendroglioma -1.100 4.8e-03
psoriasis 1.700 3.2e-04

Gene RIF (3)

AA Sequence

MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWL      1 - 70
VEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE                      71 - 123
//

Text Mined References (21)

PMID Year Title