Property Summary

NCBI Gene PubMed Count 36
Grant Count 30
R01 Count 19
Funding $4,576,026.15
PubMed Score 105.60
PubTator Score 62.79

Knowledge Summary

Patent (5,661)

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.500 0.001
pediatric high grade glioma 1.600 0.009
pilocytic astrocytoma 1.900 0.000
psoriasis -1.100 0.000

Gene RIF (22)

PMID Text
26572146 GAL and its receptors, GALR1 and GALR2, play a role in head and neck squamous cell carcinoma tumorigenesis
24706871 Variants in genes for galanin (GAL) and its receptors (GALR1, GALR2, GALR3), despite their disparate genomic loci, conferred increased risk of depression and anxiety in people who experienced childhood adversity or recent negative life events.
23727823 GALR1 methylation is associated with endometrial cancer.
22859720 Moreover, we have identified a novel role for the GalR1/galanin receptor-ligand axis in chemoresistance, providing evidence to support its further evaluation as a potential therapeutic target and biomarker in colorectal cancer .
21796100 Genetic variants in the GALR1 gene are associated with a protective effect in nicotine dependence.
21430647 The results of this study suggested an association between variation at the GALR1 locus and baseline craving for tobacco in smokers seeking cessation treatment.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20398908 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MELAVGNLSEGNASWPEPPAPEPGPLFGIGVENFVTLVVFGLIFALGVLGNSLVITVLARSKPGKPRSTT      1 - 70
NLFILNLSIADLAYLLFCIPFQATVYALPTWVLGAFICKFIHYFFTVSMLVSIFTLAAMSVDRYVAIVHS     71 - 140
RRSSSLRVSRNALLGVGCIWALSIAMASPVAYHQGLFHPRASNQTFCWEQWPDPRHKKAYVVCTFVFGYL    141 - 210
LPLLLICFCYAKVLNHLHKKLKNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHIIHLWAEFGVFPLTPA    211 - 280
SFLFRITAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRIDTPPSTNCTHV     281 - 349
//

Text Mined References (38)

PMID Year Title
26572146 2016 Epigenetic inactivation of galanin and GALR1/2 is associated with early recurrence in head and neck cancer.
25691535 2015 Galanin pathogenic mutations in temporal lobe epilepsy.
24706871 2014 Brain galanin system genes interact with life stresses in depression-related phenotypes.
24517231 2014 Coevolution of the spexin/galanin/kisspeptin family: Spexin activates galanin receptor type II and III.
23727823 2013 GALR1 methylation in vaginal swabs is highly accurate in identifying women with endometrial cancer.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22859720 2012 Identification of galanin and its receptor GalR1 as novel determinants of resistance to chemotherapy and potential biomarkers in colorectal cancer.
21796100 2011 The neuropeptide galanin and variants in the GalR1 gene are associated with nicotine dependence.
21430647 2011 The galanin receptor 1 gene associates with tobacco craving in smokers seeking cessation treatment.
More...