Property Summary

NCBI Gene PubMed Count 20
PubMed Score 56.10
PubTator Score 90.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Pellagra 26 4.037 2.0

Expression

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQG      1 - 70
KHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQ     71 - 140
LAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQ    141 - 210
VIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPA    211 - 280
CKKPLG                                                                    281 - 286
//

Text Mined References (22)

PMID Year Title