Property Summary

NCBI Gene PubMed Count 19
Grant Count 11
R01 Count 4
Funding $1,162,392.66
PubMed Score 45.83
PubTator Score 90.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Pellagra 25 3.254 1.6
Hypospadias 65

Expression

 GWAS Trait (1)

Gene RIF (4)

PMID Text
20468071 Observational study of gene-disease association. (HuGE Navigator)
20211485 Methylation status of CIDEA, HAAO and RXFP3 had significant association with microsatellite instability in endometrial tumors.
19724865 GTF2A1 alone, or GTF2A1 plus HAAO are excellent candidate biomarkers for detecting Ovarian cancer
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQG      1 - 70
KHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQ     71 - 140
LAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQ    141 - 210
VIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPA    211 - 280
CKKPLG                                                                    281 - 286
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
20211485 2010 Promoter hypermethylation of CIDEA, HAAO and RXFP3 associated with microsatellite instability in endometrial carcinomas.
19724865 2009 Identification of candidate epigenetic biomarkers for ovarian cancer detection.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
More...