Property Summary

NCBI Gene PubMed Count 191
PubMed Score 224.80
PubTator Score 171.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 1.500 1.0e-04
Astrocytoma, Pilocytic 1.100 3.3e-05
atypical teratoid / rhabdoid tumor 1.400 1.3e-03
Breast cancer 2.300 3.8e-02
Duchenne muscular dystrophy 1.149 4.6e-08
ependymoma 1.600 4.9e-02
glioblastoma 1.300 1.9e-04
intraductal papillary-mucinous carcinoma... 1.400 7.8e-03
intraductal papillary-mucinous neoplasm ... 1.200 4.9e-02
juvenile dermatomyositis 1.209 1.0e-07
lung adenocarcinoma 1.294 5.5e-06
osteosarcoma -1.506 1.5e-04
ovarian cancer -1.500 8.1e-06
pancreatic cancer 1.200 2.1e-03
pituitary cancer -1.100 6.5e-03
primary pancreatic ductal adenocarcinoma 1.330 2.0e-03
primitive neuroectodermal tumor 1.100 7.0e-03
psoriasis -1.400 7.5e-05
Rheumatoid arthritis 2.800 1.5e-02
subependymal giant cell astrocytoma 1.641 3.1e-02

Gene RIF (149)

AA Sequence

MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEE      1 - 70
GLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWLNAMDEIGLPKIFYPETTDIY     71 - 140
DRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINNMKTELEKYGIQMPAFSKIGGILANEL    141 - 210
SVDEAALHAAVIAINEAIDRRIPADTFAALKNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENS    211 - 280
ERERDVYEELLTQAEIQGNINKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQL    281 - 350
LSDKQQKRQSGQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ    351 - 420
VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLSSSVTGLTNIE    421 - 490
EENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQA    491 - 560
LQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAI    561 - 630
NEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNL    631 - 700
ETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMN    701 - 770
FLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII    771 - 840
KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLIRSNQQLENDL    841 - 910
NLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKALSKEKREKLEAYQHLFYLLQ    911 - 980
TNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFKTALQEEIKSKVDQIQEIVTGNPT    981 - 1050
VIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQ   1051 - 1120
ALAHEEVKTRLDSSIRNMRAVTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNL   1121 - 1190
LYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ   1191 - 1260
KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDD   1261 - 1330
LGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQP   1331 - 1400
GETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKKSKSVKEDSNLTLQEKKEKIQTGLKKLTELG   1401 - 1470
TVDPKNKYQELINDIARDIRNQRRYRQRRKAELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLAS   1471 - 1540
KGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGV   1541 - 1610
QMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK                          1611 - 1657
//

Text Mined References (201)

PMID Year Title