Property Summary

NCBI Gene PubMed Count 165
Grant Count 139
R01 Count 110
Funding $9,293,143.74
PubMed Score 205.97
PubTator Score 171.54

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P46940 A7MBM3
Symbols SAR1
p195
HUMORFA01

Gene

PANTHER Protein Class (2)

PDB

1X0H   2RR8   3FAY   3I6X  

Gene RIF (128)

PMID Text
27080863 Our data indicate a possible regulatory role for the multiple sclerosis-associated IKZF3 and IQGAP1 variants.
26473364 Our results identify OspB as a regulator of mTORC1 and mTORC1-dependent cell proliferation early during S. flexneri infection and establish a role for IQGAP1 in mTORC1 signaling
26398880 the present study is the first to provide evidence that miR-506 acts as a tumor suppressor, at least partially, by directly downregulating IQGAP1 in breast cancer cells.
26252773 the overexpression and interactions of IQGAP1 and beta-catenin contribute to hepatocellular carcinoma progression by promoting cell proliferation and migration.
26242911 Mechanistically, the N-terminal of SKAP binds to EB1, and its C terminus binds to IQGAP1 in migrating cells.
26195666 IQGAP1 critically mediates CXCR4 cell surface expression and signaling.
26078295 The clinical relevance of IQGAP1 as a tumor growth suppressor is supported by the finding that its expression is lower in bladder cancer compared with benign patient urothelium in multiple independent datasets.
26051604 IQGAP1 and its two isoforms regulate the actin-cytoskeleton alone and with their binding partners, Rac and Cdc42, thereby controlling diverse cellular processes, such as cell migration and adhesion. (Review)
26046126 IQGAP1 may directly interact with estrogen receptor alpha and serve as a signal integrator, mediating estrogen receptor alpha transcriptional activity, cell proliferation and cell invasion during the progression of thyroid cancer.
25928398 Depletion of IQGAP1 disrupts nuclear envelope localization and delays abscission timing.
More...

AA Sequence

MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEE      1 - 70
GLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWLNAMDEIGLPKIFYPETTDIY     71 - 140
DRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINNMKTELEKYGIQMPAFSKIGGILANEL    141 - 210
SVDEAALHAAVIAINEAIDRRIPADTFAALKNPNAMLVNLEEPLASTYQDILYQAKQDKMTNAKNRTENS    211 - 280
ERERDVYEELLTQAEIQGNINKVNTFSALANIDLALEQGDALALFRALQSPALGLRGLQQQNSDWYLKQL    281 - 350
LSDKQQKRQSGQTDPLQKEELQSGVDAANSAAQQYQRRLAAVALINAAIQKGVAEKTVLELMNPEAQLPQ    351 - 420
VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLSSSVTGLTNIE    421 - 490
EENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQA    491 - 560
LQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAI    561 - 630
NEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNL    631 - 700
ETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMN    701 - 770
FLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDII    771 - 840
KIQAFIRANKARDDYKTLINAEDPPMVVVRKFVHLLDQSDQDFQEELDLMKMREEVITLIRSNQQLENDL    841 - 910
NLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLKALSKEKREKLEAYQHLFYLLQ    911 - 980
TNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFKTALQEEIKSKVDQIQEIVTGNPT    981 - 1050
VIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQ   1051 - 1120
ALAHEEVKTRLDSSIRNMRAVTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNL   1121 - 1190
LYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQ   1191 - 1260
KFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDD   1261 - 1330
LGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQP   1331 - 1400
GETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKKSKSVKEDSNLTLQEKKEKIQTGLKKLTELG   1401 - 1470
TVDPKNKYQELINDIARDIRNQRRYRQRRKAELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLAS   1471 - 1540
KGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGV   1541 - 1610
QMETFMLHYQDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK                          1611 - 1657
//

Text Mined References (175)

PMID Year Title
27080863 2016 Allelic imbalance of multiple sclerosis susceptibility genes IKZF3 and IQGAP1 in human peripheral blood.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26473364 2015 Shigella Effector OspB Activates mTORC1 in a Manner That Depends on IQGAP1 and Promotes Cell Proliferation.
26398880 2015 miR-506 regulates breast cancer cell metastasis by targeting IQGAP1.
26252773 2015 The Overexpression of IQGAP1 and ?-Catenin Is Associated with Tumor Progression in Hepatocellular Carcinoma In Vitro and In Vivo.
26242911 2015 Signaling Scaffold Protein IQGAP1 Interacts with Microtubule Plus-end Tracking Protein SKAP and Links Dynamic Microtubule Plus-end to Steer Cell Migration.
26195666 2015 IQGAP1 promotes CXCR4 chemokine receptor function and trafficking via EEA-1+ endosomes.
26078295 2015 Patient Mutation Directed shRNA Screen Uncovers Novel Bladder Tumor Growth Suppressors.
26051604 2015 IQGAPs as Key Regulators of Actin-cytoskeleton Dynamics.
26046126 2015 IQGAP1 modulates the proliferation and invasion of thyroid cancer cells in response to estrogen.
More...