Property Summary

NCBI Gene PubMed Count 148
Grant Count 195
R01 Count 111
Funding $20,862,740.77
PubMed Score 221.46
PubTator Score 194.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
glioblastoma 1.500 0.000
lung cancer -1.200 0.012
pediatric high grade glioma 1.400 0.000
pilocytic astrocytoma 1.800 0.000
lung carcinoma -1.200 0.000
acute myeloid leukemia -1.300 0.041

Synonym

Accession P46934 A1KY35 A6ND72 A7MD29 B4E2R7 B7ZM59 B7ZM60 B9EGN5 D6RF89
Symbols RPF1
NEDD4-1

Gene

PANTHER Protein Class (2)

PDB

2M3O   5C7J   4N7H   2KPZ   2KQ0   2XBB   2XBF   3B7Y   4BBN   4BE8   4N7F   5AHT   5C91  

 GWAS Trait (2)

Gene RIF (132)

PMID Text
26854353 LRAD3 is a component of pathways that function effectively to modulate Itch and Nedd4 auto-ubiquitination and levels.
26685112 These results show that the binding of the hNedd4-1 WW3* domain to alpha-hENaC is coupled to the folding equilibrium
26503960 Elevated NEDD4 is implicated as the responsible ubiquitin E3 ligase for HSF1 degradation through ubiquitin-proteasome system. Aberrant HSF1 degradation is a key neurodegenerative mechanism underlying alpha-synucleinopathy.
26296893 HUWE1 and NEDD4-1 are two E3 ligases that are fundamental enzymes in the post-translational regulation of ABCG1 and ABCG4 protein levels and cellular cholesterol export activity
26263374 we demonstrate that the E3 ubiquitin ligase NEDD4 ubiquitinates IFITM3 in cells and in vitro.
26193427 Study identifies NEDD4 as a putative oncogene in endometrial cancer that may augment activation of the IGF-1R/PI3K/Akt signaling pathway.
26037357 rs3088077, rs7162435 and rs2303579 of the NEDD4 gene are associated with schizophrenia.
26006083 Data show that human ABCB1 is a substrate for human NEDD4-1 and identified 8 lysine residues that were ubiquitinated by NEDD4-1.
25883222 Data show that silencing of PMEPA1 protein facilitates the growth of prostate cancer cells and modulates androgen receptor (AR) through NEDD4 ubiquitin protein ligase and PTEN protein.
25879670 Nedd4-induced monoubiquitination of IRS-2 enhances IGF signalling and mitogenic activity.
More...

AA Sequence

MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHMCFKRPTRISTSNVVQMKLTPRQTALAPLIKENVQSQE      1 - 70
RSSVPSSENVNKKSSCLQISLQPTRYSGYLQSSNVLADSDDASFTCILKDGIYSSAVVDNELNAVNDGHL     71 - 140
VSSPAICSGSLSNFSTSDNGSYSSNGSDFGSCASITSGGSYTNSVISDSSSYTFPPSDDTFLGGNLPSDS    141 - 210
TSNRSVPNRNTTPCEIFSRSTSTDPFVQDDLEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTS    211 - 280
PTSLCTLLSKGSYQTSHQFIISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSL    281 - 350
QKKIVLSNNTPRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIKLMHRTS    351 - 420
ACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLGGAYPNISCLSSLKHNCSKGGPSQLLIKFAS    421 - 490
GNEGKVDNLSRDSNRDCTNELSNSCKTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRVK    491 - 560
GYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAACHLQQQQEPSPLPPGWEERQDILGRTYYVN    561 - 630
HESRRTQWKRPTPQDNLTDAENGNIQLQAQRAFTTRRQISEETESVDNRESSENWEIIREDEATMYSNQA    631 - 700
FPSPPPSSNLDVPTHLAEELNARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLP    701 - 770
PGWEEKQDERGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQG    771 - 840
FLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEERTHTDGRIFY    841 - 910
INHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVLEDSYRRIM    911 - 980
GVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDH    981 - 1050
LSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFI   1051 - 1120
IDEELFGQTHQHELKNGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDEN   1121 - 1190
ELELLMCGLGDVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAEL   1191 - 1260
YGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD              1261 - 1319
//

Text Mined References (164)

PMID Year Title
26854353 2016 Regulation of Itch and Nedd4 E3 Ligase Activity and Degradation by LRAD3.
26685112 2016 The Nedd4-1 WW Domain Recognizes the PY Motif Peptide through Coupled Folding and Binding Equilibria.
26503960 2016 NEDD4-mediated HSF1 degradation underlies ?-synucleinopathy.
26296893 2015 The E3 ubiquitin ligases, HUWE1 and NEDD4-1, are involved in the post-translational regulation of the ABCG1 and ABCG4 lipid transporters.
26263374 2015 E3 Ubiquitin Ligase NEDD4 Promotes Influenza Virus Infection by Decreasing Levels of the Antiviral Protein IFITM3.
26193427 2015 NEDD4 ubiquitin ligase is a putative oncogene in endometrial cancer that activates IGF-1R/PI3K/Akt signaling.
26037357 2015 [Association of NEDD4 gene polymorphisms with schizophrenia and its clinical characteristics in Chinese Han population].
26006083 2015 The multidrug resistance pump ABCB1 is a substrate for the ubiquitin ligase NEDD4-1.
25883222 2015 Silencing of PMEPA1 accelerates the growth of prostate cancer cells through AR, NEDD4 and PTEN.
25879670 2015 Nedd4-induced monoubiquitination of IRS-2 enhances IGF signalling and mitogenic activity.
More...