Property Summary

NCBI Gene PubMed Count 22
PubMed Score 86.53
PubTator Score 22.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.300 1.0e-02
atypical teratoid/rhabdoid tumor 1.100 8.4e-05
glioblastoma 1.400 1.4e-03
ovarian cancer -1.200 4.7e-05
subependymal giant cell astrocytoma 1.809 1.7e-02

Synonym

Accession P46926 B7Z3X4 D3DQE7
Symbols GPI
HLN
GNP1
GNPI
GNPDA

Gene

PANTHER Protein Class (1)

PDB

1NE7  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFN      1 - 70
MDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAAGGIELFVGGIGP     71 - 140
DGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVMDAREVMILITGAHKAF    141 - 210
ALYKAIEEGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKETEKS    211 - 280
QSSKKPYSD                                                                 281 - 289
//

Text Mined References (24)

PMID Year Title