Property Summary

NCBI Gene PubMed Count 21
Grant Count 3
Funding $429,528
PubMed Score 80.45
PubTator Score 22.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma 1.300 0.010
glioblastoma 1.400 0.001
atypical teratoid/rhabdoid tumor 1.100 0.000
subependymal giant cell astrocytoma 1.809 0.017
ovarian cancer 2.300 0.000

Synonym

Accession P46926 B7Z3X4 D3DQE7
Symbols GPI
HLN
GNP1
GNPI
GNPDA

Gene

PANTHER Protein Class (1)

PDB

1NE7  

Gene RIF (3)

PMID Text
21807125 Allosteric kinetics of the isoform 1 of human glucosamine-6-phosphate deaminase.
12965206 Sequence analysis and crystallographic structure of GNP1.
12616532 identification, chromosomal localization and functional analysis of cDNA encoding GNPI/Oscillin homolog named GNPI2.

AA Sequence

MKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFN      1 - 70
MDEYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFEEKIKAAGGIELFVGGIGP     71 - 140
DGHIAFNEPGSSLVSRTRVKTLAMDTILANARFFDGELTKVPTMALTVGVGTVMDAREVMILITGAHKAF    141 - 210
ALYKAIEEGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSIKEKETEKS    211 - 280
QSSKKPYSD                                                                 281 - 289
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21807125 2011 Allosteric kinetics of the isoform 1 of human glucosamine-6-phosphate deaminase.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...