Property Summary

NCBI Gene PubMed Count 47
PubMed Score 412.59
PubTator Score 170.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (24)

Disease log2 FC p
acute quadriplegic myopathy 1.338 5.3e-06
Atopic dermatitis -1.200 2.7e-04
autosomal dominant Emery-Dreifuss muscul... 1.309 5.0e-03
Breast cancer -1.700 1.0e-05
breast carcinoma -1.300 1.7e-23
colon cancer -1.300 7.2e-03
cystic fibrosis 1.800 6.1e-04
diabetes mellitus -1.200 2.4e-02
gastric carcinoma 1.500 4.4e-02
intraductal papillary-mucinous adenoma (... -2.300 2.2e-03
intraductal papillary-mucinous carcinoma... -2.700 1.8e-03
intraductal papillary-mucinous neoplasm ... -1.300 4.5e-02
limb girdle muscular dystrophy 2A 1.008 3.4e-03
lung cancer 2.100 1.4e-02
lung carcinoma 3.300 6.3e-27
medulloblastoma, large-cell 1.300 3.8e-04
non-small cell lung cancer 1.083 1.9e-05
osteosarcoma 3.314 1.9e-07
ovarian cancer -2.200 1.5e-04
pancreatic cancer 1.800 4.1e-03
permanent atrial fibrillation -1.100 1.6e-02
posterior fossa group B ependymoma -1.100 7.0e-09
primary pancreatic ductal adenocarcinoma 1.843 2.9e-03
psoriasis -1.100 8.0e-06

Gene RIF (20)

AA Sequence

MATVVVEATEPEPSGSIANPAASTSPSLSHRFLDSKFYLLVVVGEIVTEEHLRRAIGNIELGIRSWDTNL      1 - 70
IECNLDQELKLFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAVSTEVRLMITDAARHKLLVLT     71 - 140
GQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHPANKASLTLFCPEEGDWKNSNLDRHNLQDFI    141 - 210
NIKLNSASILPEMEGLSEFTEYLSESVEVPSPFDILEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGF    211 - 280
NMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTTNSDWMKNLI    281 - 350
SPDLGVVFLNVPENLKNPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKL    351 - 420
EMYVLNPVKSSKEMQYFMQQWTGTNKDKAEFILPNGQEVDLPISYLTSVSSLIVWHPANPAEKIIRVLFP    421 - 490
GNSTQYNILEGLEKLKHLDFLKQPLATQKDLTGQVPTPVVKQTKLKQRADSRESLKPAAKPLPSKSVRKE    491 - 560
SKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPIKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKP    561 - 630
KAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEKKEPKKEV    631 - 700
KKETPPKEVKKEVKKEEKKEVKKEEKEPKKEIKKLPKDAKKSSTPLSEAKKPAALKPKVPKKEESVKKDS    701 - 770
VAAGKPKEKGKIKVIKKEGKAAEAVAAAVGTGATTAAVMAAAGIAAIGPAKELEAERSLMSSPEDLTKDF    771 - 840
EELKAEEVDVTKDIKPQLELIEDEEKLKETEPVEAYVIQKEREVTKGPAESPDEGITTTEGEGECEQTPE    841 - 910
ELEPVEKQGVDDIEKFEDEGAGFEESSETGDYEEKAETEEAEEPEEDGEEHVCVSASKHSPTEDEESAKA    911 - 980
EADAYIREKRESVASGDDRAEEDMDEAIEKGEAEQSEEEADEEDKAEDAREEEYEPEKMEAEDYVMAVVD    981 - 1050
KAAEAGGAEEQYGFLTTPTKQLGAQSPGREPASSIHDETLPGGSESEATASDEENREDQPEEFTATSGYT   1051 - 1120
QSTIEISSEPTPMDEMSTPRDVMSDETNNEETESPSQEFVNITKYESSLYSQEYSKPADVTPLNGFSEGS   1121 - 1190
KTDATDGKDYNASASTISPPSSMEEDKFSRSALRDAYCSEVKASTTLDIKDSISAVSSEKVSPSKSPSLS   1191 - 1260
PSPPSPLEKTPLGERSVNFSLTPNEIKVSAEAEVAPVSPEVTQEVVEEHCASPEDKTLEVVSPSQSVTGS   1261 - 1330
AGHTPYYQSPTDEKSSHLPTEVIEKPPAVPVSFEFSDAKDENERASVSPMDEPVPDSESPIEKVLSPLRS   1331 - 1400
PPLIGSESAYESFLSADDKASGRGAESPFEEKSGKQGSPDQVSPVSEMTSTSLYQDKQEGKSTDFAPIKE   1401 - 1470
DFGQEKKTDDVEAMSSQPALALDERKLGDVSPTQIDVSQFGSFKEDTKMSISEGTVSDKSATPVDEGVAE   1471 - 1540
DTYSHMEGVASVSTASVATSSFPEPTTDDVSPSLHAEVGSPHSTEVDDSLSVSVVQTPTTFQETEMSPSK   1541 - 1610
EECPRPMSISPPDFSPKTAKSRTPVQDHRSEQSSMSIEFGQESPEQSLAMDFSRQSPDHPTVGAGVLHIT   1611 - 1680
ENGPTEVDYSPSDMQDSSLSHKIPPMEEPSYTQDNDLSELISVSQVEASPSTSSAHTPSQIASPLQEDTL   1681 - 1750
SDVAPPRDMSLYASLTSEKVQSLEGEKLSPKSDISPLTPRESSPLYSPTFSDSTSAVKEKTATCHSSSSP   1751 - 1820
PIDAASAEPYGFRASVLFDTMQHHLALNRDLSTPGLEKDSGGKTPGDFSYAYQKPEETTRSPDEEDYDYE   1821 - 1890
SYEKTTRTSDVGGYYYEKIERTTKSPSDSGYSYETIGKTTKTPEDGDYSYEIIEKTTRTPEEGGYSYDIS   1891 - 1960
EKTTSPPEVSGYSYEKTERSRRLLDDISNGYDDSEDGGHTLGDPSYSYETTEKITSFPESEGYSYETSTK   1961 - 2030
TTRTPDTSTYCYETAEKITRTPQASTYSYETSDLCYTAEKKSPSEARQDVDLCLVSSCEYKHPKTELSPS   2031 - 2100
FINPNPLEWFASEEPTEESEKPLTQSGGAPPPPGGKQQGRQCDETPPTSVSESAPSQTDSDVPPETEECP   2101 - 2170
SITADANIDSEDESETIPTDKTVTYKHMDPPPAPVQDRSPSPRHPDVSMVDPEALAIEQNLGKALKKDLK   2171 - 2240
EKTKTKKPGTKTKSSSPVKKSDGKSKPLAASPKPAGLKESSDKVSRVASPKKKESVEKAAKPTTTPEVKA   2241 - 2310
ARGEEKDKETKNAANASASKSAKTATAGPGTTKTTKSSAVPPGLPVYLDLCYIPNHSNSKNVDVEFFKRV   2311 - 2380
RSSYYVVSGNDPAAEEPSRAVLDALLEGKAQWGSNMQVTLIPTHDSEVMREWYQETHEKQQDLNIMVLAS   2381 - 2450
SSTVVMQDESFPACKIEL                                                       2451 - 2468
//

Text Mined References (63)

PMID Year Title