Property Summary

NCBI Gene PubMed Count 34
PubMed Score 55.28
PubTator Score 99.47

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

AA Sequence

MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWY      1 - 70
LTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKA     71 - 140
EAGAGSATEFQFRGGFGRGRGQPPQ                                                 141 - 165
//

Text Mined References (37)

PMID Year Title