Property Summary

NCBI Gene PubMed Count 31
Grant Count 3
R01 Count 2
Funding $322,353
PubMed Score 57.51
PubTator Score 99.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P46783 B2R4E3 Q5TZC0
Symbols S10
DBA9

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (6)

PMID Text
22672539 These results are consistent with a model in which the Nef protein by binding to two components of the 40S small ribosomal subunit, RPS10 and 18S rRNA, and to a lesser extent to tRNAs, could lead to decreased protein synthesis.
22672539 HIV-1 Nef inhibits translation in vitro by interacting with two components of the 40S small ribosomal subunits, the RPS10 protein and the 18S rRNA
22510774 A novel mutation of ribosomal protein S10 gene in a Japanese patient with diamond-Blackfan anemia.
20159986 Methylation of ribosomal protein S10 by protein-arginine methyltransferase 5 regulates ribosome biogenesis.
20116044 Mutations in the RPS10 and RPS26 genes in DBA patients affect the function of the proteins in rRNA processing.
19034380 This protein has been found differentially expressed in the temporal lobe from patients with schizophrenia.

AA Sequence

MLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGYVKEQFAWRHFYWY      1 - 70
LTNEGIQYLRDYLHLPPEIVPATLRRSRPETGRPRPKGLEGERPARLTRGEADRDTYRRSAVPPGADKKA     71 - 140
EAGAGSATEFQFRGGFGRGRGQPPQ                                                 141 - 165
//

Text Mined References (33)

PMID Year Title
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22672539 2012 The HIV-1 Nef protein interacts with two components of the 40S small ribosomal subunit, the RPS10 protein and the 18S rRNA.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22510774 2012 A novel mutation of ribosomal protein S10 gene in a Japanese patient with diamond-Blackfan anemia.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
20159986 2010 Methylation of ribosomal protein S10 by protein-arginine methyltransferase 5 regulates ribosome biogenesis.
20116044 2010 Ribosomal protein genes RPS10 and RPS26 are commonly mutated in Diamond-Blackfan anemia.
More...