Property Summary

NCBI Gene PubMed Count 30
PubMed Score 103.62
PubTator Score 31.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (5)

AA Sequence

MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPIVE      1 - 70
RLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVRRQAVD     71 - 140
VSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERVAKSNR          141 - 204
//

Text Mined References (41)

PMID Year Title