Property Summary

NCBI Gene PubMed Count 30
Grant Count 69
R01 Count 41
Funding $5,838,481.11
PubMed Score 174.70
PubTator Score 31.85

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P46782 B2R4T2 Q96BN0
Symbols S5

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (5)

PMID Text
26362536 HIV-1 Gag interacts with RPS5 as demonstrated by proximity dependent biotinylation proteomics
25712089 Data indicate that beta hairpin structure present in ribosomal protein S5 (RPS5) is important for IRES-RPS5 interaction.
22174317 HIV-1 Gag interacts with RPS5 as demonstrated by proximity dependent biotinylation proteomics
19807034 Mutual effect of human ribosomal proteins S5 and S16 on their binding with 18S rRNA fragment 1203-1236/1521-1698
17901157 Transfected into yeast cells, plays an important role in maintaining the accuracy of translation.

AA Sequence

MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPIVE      1 - 70
RLTNSMMMHGRNNGKKLMTVRIVKHAFEIIHLLTGENPLQVLVNAIINSGPREDSTRIGRAGTVRRQAVD     71 - 140
VSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELINAAKGSSNSYAIKKKDELERVAKSNR          141 - 204
//

Text Mined References (39)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25712089 2015 The beta hairpin structure within ribosomal protein S5 mediates interplay between domains II and IV and regulates HCV IRES function.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...