Property Summary

NCBI Gene PubMed Count 32
PubMed Score 26.05
PubTator Score 105.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Large intestine cancer 126 0.0 0.6
Disease Target Count Z-score Confidence
Takayasu's arteritis 53 3.907 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -3.100 4.3e-02

Gene RIF (6)

AA Sequence

MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRR      1 - 70
LFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQ     71 - 140
VVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED                    141 - 194
//

Text Mined References (43)

PMID Year Title