Property Summary

NCBI Gene PubMed Count 32
PubMed Score 21.86
PubTator Score 105.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Takayasu's arteritis 52 3.438 1.7
lung cancer 4,466

Expression

  Differential Expression (1)

Disease log2 FC p
lung cancer -3.100 0.043

Synonym

Accession P46781 A9C4C1 Q4QRK7 Q9BVZ0
Symbols S9

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (9)

PMID Text
25604533 RPS9/LILRB3 (rs11666543) was associated with Takayasu arteritis.
23285058 Evaluating different RPS9 fragments for their ability to bind NPM1 indicated that there are two binding sites for NPM1 on RPS9.
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein S9 (RPS9), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein S9 (RPS9), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein S9 (RPS9), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein S9 (RPS9), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20221446 ribosomal protein S9 silencing elicits a multitude of cellular responses inhibiting the growth of cancer cells subsequent to p53 activation
19834535 Observational study of gene-disease association. (HuGE Navigator)
18420587 B23 selectively stores, and protects ribosomal protein S9 in nucleoli and therefore could facilitate ribosome biogenesis.

AA Sequence

MPVARSWVCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRR      1 - 70
LFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQ     71 - 140
VVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKKGQGGAGAGDDEEED                    141 - 194
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25604533 2015 Identification of Susceptibility Loci in IL6, RPS9/LILRB3, and an Intergenic Locus on Chromosome 21q22 in Takayasu Arteritis in a Genome-Wide Association Study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23285058 2012 Elucidation of motifs in ribosomal protein S9 that mediate its nucleolar localization and binding to NPM1/nucleophosmin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...