Property Summary

NCBI Gene PubMed Count 29
PubMed Score 26.65
PubTator Score 18.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Weight Gain 87
Disease Target Count P-value
acute quadriplegic myopathy 1157 2.48445537917023E-5
ovarian cancer 8492 7.09988843245488E-5
colon cancer 1475 0.0011247859147695
diabetes mellitus 1663 0.00253086583503516
mucosa-associated lymphoid tissue lymphoma 480 0.00607487838360918
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00695779682395169
acute myeloid leukemia 785 0.0265149683053653
Multiple myeloma 1328 0.0473273543053578
Disease Target Count Z-score Confidence
Esophagus squamous cell carcinoma 3 3.424 1.7

Expression

  Differential Expression (8)

Synonym

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (2)

PMID Text
26362536 HIV-1 Gag interacts with RPL28 as demonstrated by proximity dependent biotinylation proteomics
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQ      1 - 70
RKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRTRPTKSS        71 - 137
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20434207 2010 Transmembrane receptor DCC associates with protein synthesis machinery and regulates translation.
More...