Property Summary

NCBI Gene PubMed Count 29
PubMed Score 27.86
PubTator Score 18.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.400 2.7e-02
acute quadriplegic myopathy 1.018 2.5e-05
colon cancer 1.200 1.1e-03
diabetes mellitus -1.300 2.1e-03
intraductal papillary-mucinous neoplasm ... -1.100 7.0e-03
mucosa-associated lymphoid tissue lympho... -1.012 6.1e-03
Multiple myeloma 1.047 4.7e-02
ovarian cancer -1.400 7.1e-05

Gene RIF (2)

AA Sequence

MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQ      1 - 70
RKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRTRPTKSS        71 - 137
//

Text Mined References (38)

PMID Year Title