Property Summary

NCBI Gene PubMed Count 29
Grant Count 2
R01 Count 2
Funding $123,580
PubMed Score 26.65
PubTator Score 18.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (2)

PMID Text
26362536 HIV-1 Gag interacts with RPL28 as demonstrated by proximity dependent biotinylation proteomics
19834535 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQ      1 - 70
RKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRTRPTKSS        71 - 137
//

Text Mined References (36)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20434207 2010 Transmembrane receptor DCC associates with protein synthesis machinery and regulates translation.
More...