Property Summary

NCBI Gene PubMed Count 23
PubMed Score 43.55
PubTator Score 20.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession P46778 Q16699
Symbols L21
HYPT12

Gene

PDB

4UG0   4V6X   5AJ0  

Gene RIF (1)

PMID Text
21412954 The cause of hereditary hypotrichosis in this family was identified as a c.95G>A (p.Arg32Gln) mutation in the ribosomal protein L21.

AA Sequence

MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQH      1 - 70
AVGIVVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHF     71 - 140
VRTNGKEPELLEPIPYEFMA                                                      141 - 160
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21412954 2011 Mutation in ribosomal protein L21 underlies hereditary hypotrichosis simplex.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
17903306 2007 Genome-wide association study of electrocardiographic and heart rate variability traits: the Framingham Heart Study.
More...