Property Summary

NCBI Gene PubMed Count 23
PubMed Score 46.09
PubTator Score 20.61

Knowledge Summary

Patent

No data available

Expression

 OMIM Phenotype (1)

Gene RIF (1)

AA Sequence

MTNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQH      1 - 70
AVGIVVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHF     71 - 140
VRTNGKEPELLEPIPYEFMA                                                      141 - 160
//

Text Mined References (29)

PMID Year Title