Property Summary

NCBI Gene PubMed Count 86
PubMed Score 78.28
PubTator Score 339.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (6)

 GWAS Trait (1)

Gene RIF (33)

AA Sequence

MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIE      1 - 70
GDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPG     71 - 140
AFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRY    141 - 210
LMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRV    211 - 280
AQKKASFLRAQERAAES                                                         281 - 297
//

Text Mined References (98)

PMID Year Title