Property Summary

NCBI Gene PubMed Count 78
Grant Count 53
R01 Count 32
Funding $4,201,748.07
PubMed Score 74.04
PubTator Score 339.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (35)

PMID Text
25301064 Ribosomal proteins L11 and L5 activate TAp73 by overcoming MDM2 inhibition.
25132370 RPL5 mutation is associated with Diamond Blackfan Anemia.
24141778 Findings uncover a mechanism by which RPL5 and RPL11 can co-operatively suppress c-Myc expression, allowing a tightly controlled ribosome biogenesis in cells.
24061479 Unlike other tumor suppressors, RPL5 and RPL11 play essential roles in normal cell proliferation.
23478443 Oncogenic splicing factor SRSF1 stabilizes the tumor suppressor protein p53 via RPL5, inducing cell senescence.
23263491 Mutations affect the ribosomal proteins RPL5 and RPL10 in 12 of 122 (9.8%) pediatric T-cell acute lymphoblastic leukemias.
23169665 disrupted nucleoli may provide a platform for L5- and L11-dependent p53 activation, implying a role for the nucleolus in p53 activation by ribosomal biogenesis stress
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L5 (RPL5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L5 (RPL5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ribosomal protein L5 (RPL5), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIE      1 - 70
GDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYEGQVEVTGDEYNVESIDGQPG     71 - 140
AFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQNVADYMRY    141 - 210
LMEEDEDAYKKQFSQYIKNSVTPDMMEEMYKKAHAAIRENPVYEKKPKKEVKKKRWNRPKMSLAQKKDRV    211 - 280
AQKKASFLRAQERAAES                                                         281 - 297
//

Text Mined References (88)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25301064 2015 Ribosomal proteins L11 and L5 activate TAp73 by overcoming MDM2 inhibition.
25132370 2014 Clinical phenotype and genetic analysis of RPS19, RPL5, and RPL11 genes in Greek patients with Diamond Blackfan Anemia.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24141778 2014 Ribosomal proteins L5 and L11 co-operatively inactivate c-Myc via RNA-induced silencing complex.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24061479 2013 Loss of tumor suppressor RPL5/RPL11 does not induce cell cycle arrest but impedes proliferation due to reduced ribosome content and translation capacity.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23478443 2013 Splicing-factor oncoprotein SRSF1 stabilizes p53 via RPL5 and induces cellular senescence.
More...