Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.61
PubTator Score 3.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
pilocytic astrocytoma 3086 5.43789989485981E-6
ependymoma 2514 0.0082397455752738
oligodendroglioma 2849 0.013333825176943
astrocytic glioma 2241 0.0178048732327355

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 0.018
ependymoma -1.400 0.008
oligodendroglioma -1.100 0.013
pilocytic astrocytoma -1.200 0.000

Synonym

Accession P46776 B2R4B3
Symbols L27A

Gene

PDB

4UG0   4V6X   5AJ0   4BXF  

  Ortholog (15)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
26362536 HIV-1 Gag interacts with RPL27AP6 as demonstrated by proximity dependent biotinylation proteomics

AA Sequence

MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHYHLKRNQSFC      1 - 70
PTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSV     71 - 140
GGACVLVA                                                                  141 - 148
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23103944 2012 Oxygenase-catalyzed ribosome hydroxylation occurs in prokaryotes and humans.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19946888 2010 Defining the membrane proteome of NK cells.
More...