Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.81
PubTator Score 3.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 1.8e-02
Astrocytoma, Pilocytic -1.300 2.3e-06
ependymoma -1.400 8.2e-03
oligodendroglioma -1.100 1.3e-02

Gene RIF (1)

AA Sequence

MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHYHLKRNQSFC      1 - 70
PTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSV     71 - 140
GGACVLVA                                                                  141 - 148
//

Text Mined References (26)

PMID Year Title