Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.61
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 0.018
ependymoma -1.400 0.008
oligodendroglioma -1.100 0.013
pilocytic astrocytoma -1.200 0.000

Synonym

Accession P46776 B2R4B3
Symbols L27A

Gene

PDB

4UG0   4V6X   5AJ0   4BXF  

Gene RIF (1)

PMID Text
26362536 HIV-1 Gag interacts with RPL27AP6 as demonstrated by proximity dependent biotinylation proteomics

AA Sequence

MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGLHHHRINFDKYHPGYFGKVGMKHYHLKRNQSFC      1 - 70
PTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSV     71 - 140
GGACVLVA                                                                  141 - 148
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23103944 2012 Oxygenase-catalyzed ribosome hydroxylation occurs in prokaryotes and humans.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19946888 2010 Defining the membrane proteome of NK cells.
More...