Property Summary

NCBI Gene PubMed Count 31
Grant Count 24
R01 Count 24
Funding $1,445,500.53
PubMed Score 11.79
PubTator Score 21.24

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26344097 KIAA0157 allosterically activates a cognate deubiquitinating enzyme (DUB) partner and implicates super dimerization as a new regulatory mechanism underlying BRCC36 DUB activity.
26024915 BRCC3 inversely correlated with NPC overall and relapse-free survival. Its expression was higher in radioresistant NPC cells, where BRCC3 knockdown increased the cell survival fraction, attenuated DNA damage repair and resulted in G2/M cell cycle arrest.
26001790 BRCC3 likely plays a role as tumor-associated gene in myelodysplastic syndromes and myelodysplastic/myeloproliferative neoplasms.
25337721 upregulation of BRCC3 expression is associated with glioma.
21596366 these data strongly suggest that BRCC3, a deubiquitinating enzyme that is part of the cellular BRCA1 and BRISC complexes, is an important player in angiogenesis and that BRCC3 loss-of-function mutations are associated with moyamoya angiopathy.
21282113 NBA1/MERIT40 and BRE interaction is required for the integrity of two distinct deubiquitinating enzyme BRCC36-containing complexes
20656690 scaffold proteins not only participate in the regulation of BRCC36 activity but also determine its subcellular localization and cellular functions.
19214193 Specificity for K63-linked polyubiquitin is a common property of the JAMM/MPN+ family of deubiquitinating enzymes.
18077395 the human Ubc13/Rnf8 ubiquitin ligases control foci formation of the Rap80/Abraxas/Brca1/Brcc36 complex in response to DNA damage
17143545 These findings demonstrate that BRCC3 is a novel effector of Raf-1, and implicate a role of BRCC3 in modulation of p-ERK, cell survival and proliferation.

AA Sequence

MAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVR      1 - 70
IVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQA     71 - 140
MYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYE    141 - 210
RIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVS    211 - 280
GPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE                                      281 - 316
//

Text Mined References (38)

PMID Year Title
26344097 2015 Higher-Order Assembly of BRCC36-KIAA0157 Is Required for DUB Activity and Biological Function.
26195665 2015 The deubiquitinating enzyme complex BRISC is required for proper mitotic spindle assembly in mammalian cells.
26024915 2015 BRCC3 acts as a prognostic marker in nasopharyngeal carcinoma patients treated with radiotherapy and mediates radiation resistance in vitro.
26001790 2015 BRCC3 mutations in myeloid neoplasms.
25337721 2014 Downregulation of BRCA1-BRCA2-containing complex subunit 3 sensitizes glioma cells to temozolomide.
25283148 2014 ABRO1 suppresses tumourigenesis and regulates the DNA damage response by stabilizing p53.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21596366 2011 Loss of BRCC3 deubiquitinating enzyme leads to abnormal angiogenesis and is associated with syndromic moyamoya.
21335604 2011 The BRCA1-RAP80 complex regulates DNA repair mechanism utilization by restricting end resection.
More...