Property Summary

NCBI Gene PubMed Count 66
Grant Count 133
R01 Count 101
Funding $7,993,117.31
PubMed Score 178.81
PubTator Score 66.71

Knowledge Summary

Patent (12,683)

Expression

Synonym

Accession P46734 B3KSK7 Q99441 Q9UE71 Q9UE72 MAP kinase kinase 3
Symbols MEK3
MKK3
MAPKK3
PRKMK3
SAPKK2
SAPKK-2

Gene

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (32)

PMID Text
26573508 MKK3 overexpression upregulated the cyclin-dependent kinase inhibitors, p16 INK4A and p15 INK4B in hepatocellular carcinoma cells was Bim1, was downregulated following MKK3 overexpression.
26149640 miR-21 targets MKK3 in vivo and in vitro, inhibiting the downstream factors IL-6 and TNF-alpha, in ischemia pretreatment protection from ischemia-reperfusion induced kidney injury.
24742347 The interaction of HIV-1 Tat with cellular transcription factors CDK9 and Sp1 is required for Tat activation of MAP2K3-, MAP2K6-, and IRF7-mediated luciferase transcription
24487387 study detected higher MKK3 activation in isolated peripheral blood mononuclear cells from septic patients compared with nonseptic controls
24480516 Our results suggest that asthma is associated with MKK3 over-expression in CD8+ cells; we have also demonstrated that MKK3 may be critical for airway neutrophilia
24112539 MicroRNA-21 promotes hepatocellular carcinoma HepG2 cell proliferation through repression of mitogen-activated protein kinase-kinase 3.
23825110 study concludes MAP2K3 is a reproducible obesity locus that may affect body weight via complex mechanisms involving appetite regulation and hypothalamic inflammation
23535064 The interaction of HIV-1 Tat with cellular transcription factors CDK9 and Sp1 is required for Tat activation of MAP2K3-, MAP2K6-, and IRF7-mediated luciferase transcription
22696064 miR-20a acts in a feedback loop to repress the expression of MKK3 and to negatively regulate the p38 pathway-mediated VEGF-induced endothelial cell migration and angiogenesis
22164285 the balance between MKK6 and MKK3 mediates p38 MAPK associated resistance to cisplatin in NSCLC
More...

AA Sequence

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISEL      1 - 70
GRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICM     71 - 140
ELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFG    141 - 210
ISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQ    211 - 280
VVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS       281 - 347
//

Text Mined References (73)

PMID Year Title
26573508 2016 Mitogen-activated protein kinase kinase 3 induces cell cycle arrest via p38 activation mediated Bmi-1 downregulation in hepatocellular carcinoma.
26149640 2016 Elevation of miR-21, through targeting MKK3, may be involved in ischemia pretreatment protection from ischemia-reperfusion induced kidney injury.
24487387 2014 MKK3 regulates mitochondrial biogenesis and mitophagy in sepsis-induced lung injury.
24480516 2014 A role for mitogen kinase kinase 3 in pulmonary inflammation validated from a proteomic approach.
24112539 2013 MicroRNA-21 promotes hepatocellular carcinoma HepG2 cell proliferation through repression of mitogen-activated protein kinase-kinase 3.
23825110 2013 MAP2K3 is associated with body mass index in American Indians and Caucasians and may mediate hypothalamic inflammation.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22696064 2012 miR-20a represses endothelial cell migration by targeting MKK3 and inhibiting p38 MAP kinase activation in response to VEGF.
22164285 2011 Balance between MKK6 and MKK3 mediates p38 MAPK associated resistance to cisplatin in NSCLC.
More...