Property Summary

Ligand Count 4
NCBI Gene PubMed Count 71
PubMed Score 190.89
PubTator Score 66.71

Knowledge Summary

Patent (12,683)

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia 1.100 7.0e-03
Breast cancer -1.300 4.1e-12
glioblastoma 1.200 1.4e-02
intraductal papillary-mucinous adenoma (... 1.200 4.5e-03
intraductal papillary-mucinous carcinoma... 1.200 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.400 1.3e-02
lung cancer -2.600 2.2e-05
non diabetic and post-ischemic heart fai... -1.400 5.7e-03
osteosarcoma -1.449 1.7e-02
ovarian cancer 2.200 4.2e-09
psoriasis -2.100 4.8e-05
ulcerative colitis 1.100 8.0e-06

 GWAS Trait (1)

Gene RIF (36)

AA Sequence

MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISEL      1 - 70
GRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICM     71 - 140
ELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFG    141 - 210
ISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQ    211 - 280
VVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS       281 - 347
//

Text Mined References (78)

PMID Year Title