Property Summary

NCBI Gene PubMed Count 47
PubMed Score 308.21
PubTator Score 213.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung adenocarcinoma 2714 2.29478599741239E-15
glioblastoma multiforme 347 3.8702299252336E-11
psoriasis 6685 1.57890621854183E-8
ovarian cancer 8492 1.43541066444039E-6
lung carcinoma 2844 2.87029345766693E-6
posterior fossa group A ependymoma 1511 2.37131806099578E-4
medulloblastoma 1524 6.18575418969667E-4
subependymal giant cell astrocytoma 2287 0.00393410556704583
atypical teratoid/rhabdoid tumor 1095 0.00410337001879636
Pick disease 1893 0.0151745100327293
Disease Target Count Z-score Confidence
Central nervous system disease 10 0.0 2.0
Disease Target Count
progressive supranuclear palsy 674

Expression

  Differential Expression (11)

Disease log2 FC p
progressive supranuclear palsy -2.200 0.011
glioblastoma multiforme -1.500 0.000
posterior fossa group A ependymoma -1.400 0.000
medulloblastoma -1.400 0.001
lung adenocarcinoma -1.600 0.000
atypical teratoid/rhabdoid tumor -1.200 0.004
subependymal giant cell astrocytoma -1.562 0.004
lung carcinoma -1.200 0.000
Pick disease -1.400 0.015
ovarian cancer -1.200 0.000
psoriasis -1.100 0.000

Synonym

Accession P46721 Q9UGP7 Q9UL38
Symbols OATP
OATP-A
OATP1A2
SLC21A3

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (36)

PMID Text
25924632 Genetic polymorphisms and function of the OATP1A2 and its clinical relevance in drug disposition
25560245 Report OATP1A2 expression in human retinal pigmented epithelial cells and suggest role in cellular uptake of all-trans retinol.
25387129 analysis of how the transmembrane domain 6 of the human organic anion transporting polypeptide 1A2 (OATP1A2) influences transporter substrate binding, protein trafficking, and quality control
24825069 human OATP1B1, OATP1B3 and OATP1A2 can transport docetaxel in vivo.
24728453 PDZK1 and NHERF1 regulate the transport function of OATP1A2 by modulating protein internalization via a clathrin-dependent pathway and by enhancing protein stability.
24671357 Combined high OATP1A2/high OCT6 may be a potential predictor of response to anthracycline/taxane-based chemotherapy in breast cancer
23918469 Five novel single nucleotide polymorphisms (SNIP)S in the coding exons of SLCO1A2 gene transporter have been identified.
23243220 Human OATP1A/1B transporters play an important role in plasma and tissue distribution of the structurally diverse chemotherapeutics methotrexate and paclitaxel
22864060 results suggest that enhanced OATP1A2 expression is associated with adaptive cell growth of prostate cancer cells under androgen-depleted conditions
22509823 Hydrophilic anti-migraine triptans are substrates for OATP1A2, a transporter expressed at human blood-brain barrier.
More...

AA Sequence

MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGFINGSFEIGNL      1 - 70
LLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVSVSGNLSSNSFLCMENGTQIL     71 - 140
RPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGISYIEDFAKFENSPLYIGLVETGAIIGPLIG    141 - 210
LLLASFCANVYVDTGFVNTDDLIITPTDTRWVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNAD    211 - 280
IIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGIS    281 - 350
SSDAIFLMGIYNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT    351 - 420
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTS    421 - 490
GNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMKSEEKSLGVGLHTFCTRVFAG    491 - 560
IPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRKCHLPG    561 - 630
ENASSGTELIETKVKGKENECKDIYQKSTVLKDDELKTKL                                  631 - 670
//

Text Mined References (49)

PMID Year Title
25924632 2015 Genetic polymorphisms and function of the organic anion-transporting polypeptide 1A2 and its clinical relevance in drug disposition.
25560245 2015 Human organic anion transporting polypeptide 1A2 (OATP1A2) mediates cellular uptake of all-trans-retinol in human retinal pigmented epithelial cells.
25387129 2015 Putative transmembrane domain 6 of the human organic anion transporting polypeptide 1A2 (OATP1A2) influences transporter substrate binding, protein trafficking, and quality control.
24825069 2015 Human OATP1B1, OATP1B3 and OATP1A2 can mediate the in vivo uptake and clearance of docetaxel.
24728453 2014 PDZK1 and NHERF1 regulate the function of human organic anion transporting polypeptide 1A2 (OATP1A2) by modulating its subcellular trafficking and stability.
24671357 2014 Expression of organic anion-transporting polypeptide 1A2 and organic cation transporter 6 as a predictor of pathologic response to neoadjuvant chemotherapy in triple negative breast cancer.
23918469 2013 Functional analysis of novel polymorphisms in the human SLCO1A2 gene that encodes the transporter OATP1A2.
23243220 2013 Influence of human OATP1B1, OATP1B3, and OATP1A2 on the pharmacokinetics of methotrexate and paclitaxel in humanized transgenic mice.
22864060 2012 Enhanced expression of organic anion transporting polypeptides (OATPs) in androgen receptor-positive prostate cancer cells: possible role of OATP1A2 in adaptive cell growth under androgen-depleted conditions.
22509823 2012 Hydrophilic anti-migraine triptans are substrates for OATP1A2, a transporter expressed at human blood-brain barrier.
More...