Property Summary

NCBI Gene PubMed Count 61
Grant Count 49
R01 Count 35
Funding $5,180,984.66
PubMed Score 105.70
PubTator Score 88.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
25684507 High expression of IER3 is associated with hepatocarcinoma.
25666857 findings suggest that IER3 is a putative tumor suppressor in the cervix, and the c-Ab1/p73beta/IER3 axis is a novel and crucial signaling pathway that confers etoposide chemosensitivity.
25066273 interleukin-1beta (IL-1beta)-induced IER3 expression is mediated by the ERK1/2 target, transcription factor Elk-1.
25036043 In human samples removed from failed AVF, there was a significant increase in IEX-1 expression localized to the adventitia.
24311782 the interference of IER3 with the PI3K/Akt-Fyn pathway represents a novel mechanism of Nrf2 regulation that may get lost in tumors and by which IER3 exerts its stress-adaptive and tumor-suppressive activity.
24162774 HIV-1 gp120 upregulates the expression of immediate early response 3 (IER3) in human B cells
23725081 IEX-1 expression levels correlate with the severity of preeclampsia
23403649 Studied the binding effect of hcmv-miR-UL148D to the 3' untranslated region (3'UTR) of IEX-1.Results showed that only one binding site in the 3'UTR of IEX-1 was completely complementary to an 11nt sequence in the 5' terminus of hcmv-mir-UL148D.
22085302 Altered IEX-1 expression can potentially be a new predictor of the malignant transformation and a prognostic indicator for cancer therapy.
21518511 Changes of methylation status of gene IEX-1 promoter CpG island correlates with hematologic malignancies.
More...

AA Sequence

MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRV      1 - 70
VRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSD     71 - 140
YALDLSTFLQQHPAAF                                                          141 - 156
//

Text Mined References (64)

PMID Year Title
25684507 2015 Expression of IER3 in primary hepatocarcinoma: correlation with clinicopathological parameters.
25666857 2015 IER3 is a crucial mediator of TAp73?-induced apoptosis in cervical cancer and confers etoposide sensitivity.
25066273 2014 Transcription factor Elk-1 participates in the interleukin-1?-dependent regulation of expression of immediate early response gene 3 (IER3).
25036043 2014 The role of Iex-1 in the pathogenesis of venous neointimal hyperplasia associated with hemodialysis arteriovenous fistula.
24311782 2014 Modulation of nuclear factor E2-related factor-2 (Nrf2) activation by the stress response gene immediate early response-3 (IER3) in colonic epithelial cells: a novel mechanism of cellular adaption to inflammatory stress.
23725081 2013 The expression of immediate early response gene X-1 in preeclampsia placenta and its pro-apoptotic role in preeclampsia.
23455636 2013 Seven new loci associated with age-related macular degeneration.
23403649 2013 Identification of immediate early gene X-1 as a cellular target gene of hcmv-mir-UL148D.
22565310 2012 Nuclear protein 1 promotes pancreatic cancer development and protects cells from stress by inhibiting apoptosis.
22085302 2011 Clinical significance of IEX-1 expression in ovarian carcinoma.
More...