Property Summary

NCBI Gene PubMed Count 64
PubMed Score 112.02
PubTator Score 88.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P46695 Q5SU30 Q92691 Q93044
Symbols DIF2
IEX1
PRG1
DIF-2
GLY96
IEX-1
IEX-1L

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA Inparanoid

Gene RIF (44)

AA Sequence

MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRV      1 - 70
VRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSD     71 - 140
YALDLSTFLQQHPAAF                                                          141 - 156
//

Text Mined References (67)

PMID Year Title