Property Summary

NCBI Gene PubMed Count 30
PubMed Score 254.96
PubTator Score 155.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

AA Sequence

MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSL      1 - 70
KLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAE     71 - 140
ELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFD    141 - 210
IPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGIL    211 - 280
VIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK         281 - 345
//

Text Mined References (34)

PMID Year Title