Property Summary

NCBI Gene PubMed Count 904
PubMed Score 11093.28
PubTator Score 1380.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 9.03937648024455E-14
pilocytic astrocytoma 3086 1.24431876937319E-5
group 4 medulloblastoma 1875 1.69448020157494E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.72087725256744E-5
pediatric high grade glioma 2712 0.00117244351985357
oligodendroglioma 2849 0.00339844154173729
astrocytic glioma 2241 0.00672456239930459
ependymoma 2514 0.0140764796094425
primitive neuroectodermal tumor 3031 0.0203750823089681
gastric carcinoma 832 0.0288862194679075
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Immune system cancer 38 0.0 1.0
Lymphoid leukemia 69 0.0 1.0
Disease Target Count Z-score Confidence
Head and neck squamous cell carcinoma 12 0.0 5.0

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma 1.500 0.000
astrocytic glioma 1.700 0.007
ependymoma 2.200 0.014
oligodendroglioma 2.500 0.003
primitive neuroectodermal tumor 1.200 0.020
intraductal papillary-mucinous adenoma (... -1.600 0.000
pediatric high grade glioma 1.500 0.001
group 4 medulloblastoma -1.700 0.000
pilocytic astrocytoma 1.300 0.000
lung carcinoma -1.300 0.000
gastric carcinoma 1.300 0.029

Synonym

Accession P46531 Q59ED8 Q5SXM3 Notch 1
Symbols hN1
AOS5
TAN1
AOVD1

Gene

PDB

2F8X   3NBN   3V79   1PB5   1TOZ   1YYH   2F8Y   2HE0   2VJ3   3ETO   3I08   3L95   4CUD   4CUE   4CUF   4D0E   4D0F   5FM9   5FMA  

  Ortholog (9)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
434982 screening 61 / 0 / 15299 Cell-based luminescence-based Maybridge primary high throughput screening assay to identify agonists of NOTCH
434983 summary 0 / 0 / 0 Summary of probe development efforts to identify agonists of NOTCH

Gene RIF (837)

PMID Text
27117272 Inhibition of WNT signaling by the PORCN inhibitor WNT974 reduced metastatic spread of UM-SCC cells, especially in UM-SCCs with Notch1 deficiency.
27048872 GATA3-mediated positive and negative feedback mechanisms via restraining Notch1 activity control human T-cell lineage commitment.
26967479 Targeting NOTCH1 signaling, suppresses melanoma tumor growth.
26943148 Notch signaling appears to play an important role in human meibomian gland epithelial differentiation and oil production.
26921446 Jagged1 fragments exert disparate effects on PC3 prostate cancer cell behaviour and Notch signaling.
26870802 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling
26837467 Autophagy impacts stem cell differentiation by degrading Notch1.
26766164 Evidence supporting a genetic basis includes the autosomal dominance of Bicuspid aortic valve inheritance patterns, and the identification of mutations in Notch homolog 1.
26765751 preliminary test using synthetic human NOTCH1 EGF modules showed significant inhibitory effects on the proliferation and adhesiveness of human breast cancer cell line MCF-7 and lung adenocarcinoma epithelial cell line A549
26759717 Data suggest that FAM84B protein and the NOTCH pathway are involved in the progression of esophageal squamous cell carcinoma (ESCC) and may be potential diagnostic targets for ESCC susceptibility.
More...

AA Sequence

MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDPNPCLSTPCKN      1 - 70
AGTCHVVDRRGVADYACSCALGFSGPLCLTPLDNACLTNPCRNGGTCDLLTLTEYKCRCPPGWSGKSCQQ     71 - 140
ADPCASNPCANGGQCLPFEASYICHCPPSFHGPTCRQDVNECGQKPGLCRHGGTCHNEVGSYRCVCRATH    141 - 210
TGPNCERPYVPCSPSPCQNGGTCRPTGDVTHECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYN    211 - 280
CRCPPEWTGQYCTEDVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATC    281 - 350
HDRVASFYCECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA    351 - 420
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVN    421 - 490
TDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCTEGYTG    491 - 560
THCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHHCETNINECSSQPCRHGGTCQDRDNAYLCFCL    561 - 630
KGTTGPNCEINLDDCASSPCDSGTCLDKIDGYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGF    631 - 700
TCRCPEGYHDPTCLSEVNECNSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCVNGGTCKD    701 - 770
MTSGYVCTCREGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRN    771 - 840
GGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYSGRNCETDIDD    841 - 910
CRPNPCHNGGSCTDGINTAFCDCLPGFRGTFCEEDINECASDPCRNGANCTDCVDSYTCTCPAGFSGIHC    911 - 980
ENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSQPCLHGGTCQDGCGSYRCTCPQG    981 - 1050
YTGPNCQNLVHWCDSSPCKNGGKCWQTHTQYRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVARLCQHGG   1051 - 1120
LCVDAGNTHHCRCQAGYTGSYCEDLVDECSPSPCQNGATCTDYLGGYSCKCVAGYHGVNCSEEIDECLSH   1121 - 1190
PCQNGGTCLDLPNTYKCSCPRGTQGVHCEINVDDCNPPVDPVSRSPKCFNNGTCVDQVGGYSCTCPPGFV   1191 - 1260
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGGTCAVASNTAR   1261 - 1330
GFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTGPECQFPASSPCLGGNPCYNQ   1331 - 1400
GTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDIPPPLIEEACELPECQEDAGNKVCSLQCNNH   1401 - 1470
ACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHF   1471 - 1540
SDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDA   1541 - 1610
HGQQMIFPYYGREEELRKHPIKRAAEGWAAPDALLGQVKASLLPGGSEGGRRRRELDPMDVRGSIVYLEI   1611 - 1680
DNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFV   1681 - 1750
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDLET   1751 - 1820
KKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRGPDGFTPLMIASC   1821 - 1890
SGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNM   1891 - 1960
GRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKS   1961 - 2030
ALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI   2031 - 2100
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPGVQGKKVRKPSSKGLACGS   2101 - 2170
KEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSVPLNHLPGMPDT   2171 - 2240
HLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVASGTSTVLGSSSGGALNFTVGGSTSLNGQCEW   2241 - 2310
LSRLQSGMVPNQYNPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLV   2311 - 2380
QTQQVQPQNLQMQQQNLQPANIQQQQSLQPPPPPPQPHLGVSSAASGHLGRSFLSGEPSQADVQPLGPSS   2381 - 2450
LAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQW   2451 - 2520
SSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK                                      2521 - 2555
//

Text Mined References (908)

PMID Year Title
27117272 2016 In vivo Wnt pathway inhibition of human squamous cell carcinoma growth and metastasis in the chick chorioallantoic model.
27048872 2016 GATA3 induces human T-cell commitment by restraining Notch activity and repressing NK-cell fate.
26967479 2016 Synchronized Targeting of Notch and ERBB Signaling Suppresses Melanoma Tumor Growth through Inhibition of Notch1 and ERBB3.
26943148 2016 Notch Signaling in Meibomian Gland Epithelial Cell Differentiation.
26921446 2016 Stroma-induced Jagged1 expression drives PC3 prostate cancer cell migration; disparate effects of RIP-generated proteolytic fragments on cell behaviour and Notch signaling.
26870802 2015 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling.
26837467 2016 Autophagy regulates Notch degradation and modulates stem cell development and neurogenesis.
26766164 2016 Advances in aortic disease management: a year in review.
26765751 2016 Synthetic Human NOTCH1 EGF Modules Unraveled Molecular Mechanisms for the Structural and Functional Roles of Calcium Ions and O-Glycans in the Ligand-Binding Region.
26759717 2016 Genomic analyses reveal FAM84B and the NOTCH pathway are associated with the progression of esophageal squamous cell carcinoma.
More...