Property Summary

NCBI Gene PubMed Count 779
Grant Count 577
R01 Count 416
Funding $49,991,392.68
PubMed Score 1211.33
PubTator Score 1417.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.305 0.003
Multiple Sclerosis -1.300 0.001
subependymal giant cell astrocytoma -2.371 0.018
psoriasis -1.100 0.000
ovarian cancer -1.600 0.000

Synonym

Accession P46527 Q16307 Q5U0H2 Q9BUS6
Symbols KIP1
MEN4
CDKN4
MEN1B
P27KIP1

Gene

PDB

2AST   1H27   1JSU  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
463171 other 0 / 0 / 2 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of Wee1 degradation: luminescence-based cell-based assay to identify inhibitors of p27 (CDKN1B) degradation

Gene RIF (728)

PMID Text
27035903 measurements comprising the receptors EGFR, ERBB3 (HER3), and the cyclin-dependent kinase inhibitor p27 (CDKN1B) was found to accurately predict dependence on PI3K/AKT vs. MAPK/ERK signaling axes in HER2+ cancers
26940882 Estrogen-related receptor gamma is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26911146 Data show that KDM5B is frequently up-regulated in hepatocellular carcinoma tissues and cell lines and correlated with poor prognosis. Its depletion leads to highly impaired clonogenesis and cell cycle arrest through up-regulation of p15 and p27.
26874904 These results define a novel mechanism by which PKM2 regulates glioma cell growth, and also define a novel set of potential therapeutic targets along the PKM2-HuR-p27 pathway
26847530 These findings provide evidence that miR-24 has a tumor suppressor role in prostate cancer and also targets p27 and p16 in prostate cancer cells
26775844 These findings provide further evidence that histatin 3 may be involved in the regulation of cell proliferation, particularly during G1/S transition, via the ubiquitin-proteasome system of p27(Kip1) and HSC70.
26701207 p27 overrides Myc's suppression of senescence independent of Ser-62 and induces Myc degradation independent of Cdk2 by binding Myc via its C-terminus. Further, high expression of active p27 protein significantly correlated with low Myc protein level in human breast cancer.
26687548 These findings indicate that NSun2-mediated mRNA methylation regulates p27 and CDK1 levels during replicative senescence.
26682002 HDACIs increase p27(Kip1) by hampering its nuclear ubiquitination/degradation
26677902 Clioquinol suppressed cell cycle progression in the S-phase in SMMC-7721 hepatoma cells via the p21, p27-cyclin E,A/Cdk2 pathway.
More...

AA Sequence

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPL      1 - 70
EGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDS     71 - 140
QTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT                141 - 198
//

Text Mined References (790)

PMID Year Title
27035903 2016 HER2+ Cancer Cell Dependence on PI3K vs. MAPK Signaling Axes Is Determined by Expression of EGFR, ERBB3 and CDKN1B.
26940882 2016 Estrogen-related receptor ? is upregulated in liver cancer and its inhibition suppresses liver cancer cell proliferation via induction of p21 and p27.
26911146 2016 Depletion of histone demethylase KDM5B inhibits cell proliferation of hepatocellular carcinoma by regulation of cell cycle checkpoint proteins p15 and p27.
26874904 2016 PKM2 uses control of HuR localization to regulate p27 and cell cycle progression in human glioblastoma cells.
26847530 2016 miR-24 regulates CDKN1B/p27 expression in prostate cancer.
26775844 2016 Salivary protein histatin 3 regulates cell proliferation by enhancing p27(Kip1) and heat shock cognate protein 70 ubiquitination.
26701207 2016 Interferon-?-induced p27KIP1 binds to and targets MYC for proteasome-mediated degradation.
26687548 2015 NSun2 delays replicative senescence by repressing p27 (KIP1) translation and elevating CDK1 translation.
26682002 2016 Histone Deacetylase Inhibitors Increase p27(Kip1) by Affecting Its Ubiquitin-Dependent Degradation through Skp2 Downregulation.
26677902 2015 Induction of cell cycle arrest via the p21, p27-cyclin E,A/Cdk2 pathway in SMMC-7721 hepatoma cells by clioquinol.
More...