Property Summary

NCBI Gene PubMed Count 830
PubMed Score 1246.58
PubTator Score 1417.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
psoriasis 6694 3.2e-11
ovarian cancer 8520 6.5e-06
Multiple Sclerosis 540 1.4e-03
Multiple myeloma 1332 2.6e-03
subependymal giant cell astrocytoma 2287 1.8e-02
Disease Target Count Z-score Confidence
Systemic lupus erythematosus 194 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 5.91 3.0

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.305 2.6e-03
Multiple Sclerosis -1.300 1.4e-03
ovarian cancer -1.600 6.5e-06
psoriasis -1.100 3.2e-11
subependymal giant cell astrocytoma -2.371 1.8e-02

Protein-protein Interaction (2)

Gene RIF (773)

AA Sequence

MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPL      1 - 70
EGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDS     71 - 140
QTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT                141 - 198
//

Text Mined References (841)

PMID Year Title