Property Summary

NCBI Gene PubMed Count 61
Grant Count 302
R01 Count 121
Funding $194,038,855.41
PubMed Score 669.63
PubTator Score 904.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.449 0.000
astrocytic glioma -2.400 0.001
ependymoma -2.800 0.002
oligodendroglioma -1.900 0.000
glioblastoma -2.800 0.000
sonic hedgehog group medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -2.000 0.000
acute quadriplegic myopathy 1.179 0.000
pediatric high grade glioma -2.400 0.000
pilocytic astrocytoma -1.800 0.000
lung carcinoma 1.700 0.000
Pick disease -1.800 0.009
invasive ductal carcinoma 1.100 0.011
ovarian cancer 1.600 0.000

Synonym

Accession P46459 A8K2D9 B4DFA2 Q8N6D7 Q9UKZ2
Symbols SKD2

Gene

NSF

Gene RIF (26)

PMID Text
23775070 a processive helicase-like mechanism for NSF in which approximately 1 residue is unwound for every hydrolyzed ATP molecule.
23125841 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22808325 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21680744 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21680744 Tandem affinity purification and mass spectrometry analysis identify N-ethylmaleimide-sensitive factor (NSF), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21426264 Single and multiple-marker analyses revealed a strong association between cocaine dependence and the NSF gene.
21324905 Knockdown of TRX1 increases the level of S-nitrosylated NSF, prolongs the inhibition of exocytosis, and suppresses leukocyte
More...

AA Sequence

MAGRSMQAARCPTDELSLTNCAVVNEKDFQSGQHVIVRTSPNHRYTFTLKTHPSVVPGSIAFSLPQRKWA      1 - 70
GLSIGQEIEVSLYTFDKAKQCIGTMTIEIDFLQKKSIDSNPYDTDKMAAEFIQQFNNQAFSVGQQLVFSF     71 - 140
NEKLFGLLVKDIEAMDPSILKGEPATGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIIN    141 - 210
PDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMGCKHVKGILLYGPPGCGKTLLARQIGKMLNAR    211 - 280
EPKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTV    281 - 350
VNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRGHQLL    351 - 420
SADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKP    421 - 490
AFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEES    491 - 560
NFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLL    561 - 630
KKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKG    631 - 700
KKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD                              701 - 744
//

Text Mined References (67)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23775070 2013 Processive ATP-driven substrate disassembly by the N-ethylmaleimide-sensitive factor (NSF) molecular machine.
23544013 2013 Genome-wide association study in BRCA1 mutation carriers identifies novel loci associated with breast and ovarian cancer risk.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22045810 2011 Protein-tyrosine phosphatase 1B modulates early endosome fusion and trafficking of Met and epidermal growth factor receptors.
21812969 2011 Genome-wide association study identifies candidate genes for Parkinson's disease in an Ashkenazi Jewish population.
21426264 2012 Candidate pathway association study in cocaine dependence: the control of neurotransmitter release.
21324905 2011 Thioredoxin increases exocytosis by denitrosylating N-ethylmaleimide-sensitive factor.
More...