Property Summary

NCBI Gene PubMed Count 24
Grant Count 2
R01 Count 1
Funding $100,124.57
PubMed Score 11.31
PubTator Score 11.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession P46439 A8K0V8 Q6PD78
Symbols GTM5
GSTM5-5

Gene

 Grant Application (2)

Gene RIF (12)

PMID Text
22410570 The evidence presented suggests that GSTM1 and GSTM5 undergo epigenetic repression in AMD RPE/choroid, which may increase susceptibility to oxidative stress in AMD retinas.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20200426 Observational study of gene-disease association. (HuGE Navigator)
19856098 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19336475 Observational study of gene-disease association. (HuGE Navigator)
19151192 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKI      1 - 70
TQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSE     71 - 140
FLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFG    141 - 210
KSATWNSK                                                                  211 - 218
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22410570 2012 DNA methylation is associated with altered gene expression in AMD.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20200426 2010 Glutathione pathway genetic polymorphisms and lung cancer survival after platinum-based chemotherapy.
19856098 2010 Genetic variants in GSTM3 gene within GSTM4-GSTM2-GSTM1-GSTM5-GSTM3 cluster influence breast cancer susceptibility depending on GSTM1.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19151192 2009 Variation in the GST mu locus and tobacco smoke exposure as determinants of childhood lung function.
More...