Property Summary

NCBI Gene PubMed Count 92
Grant Count 27
R01 Count 14
Funding $1,786,039.33
PubMed Score 601.81
PubTator Score 132.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.443 0.000
astrocytoma 1.100 0.020
medulloblastoma 1.100 0.000
ovarian cancer 1.900 0.000

Gene RIF (61)

PMID Text
26663859 The observations suggest a mechanism whereby the BAG6 ubiquitin-linked domain provides a platform for discriminating substrates with shorter hydrophobicity stretches as a signal for defective proteins.
26598275 we found BAG6 to be dispensable in antigen processing
26153132 BAG6 co-localizes with HSPA2 in huinan testicular germ cells and epididymal spermatozoa, moving from the equator to the anterior head during capacitation and stably interacting with HSPA2. In zona pellucida binding defect infertility, BAG6 is lacking.
25884493 BAG6 rs3117582 SNP was associated with non small cell lung cancer in the Norwegian subjects and the combined Croatian-Norwegian subjects corroborating the earlier finding that BAG6 rs3117582 SNP was associated with lung cancer in Europeans.
25535373 Both TRC35 and Ubl4A have distinct C-terminal binding sites on Bag6 defining a minimal Bag6 complex.
25430685 This meta-analysis suggested that HLA-B-associated transcript 3 polymorphisms are risk factors for lung cancer.
25415308 Data show that molecular chaperone BAG6_ubiquitin-like domain (UBL) and ubiquitin-like 4A UBL4A_UBL compete for the same binding site on N-terminal dimerisation domain of SGTA protein (SGTA_NT).
25231575 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
25111513 The BAT2/BAT3 polymorphisms and specifically the A/C haplotype may represent a novel immunogenetic factor associated with graft rejection in patients undergoing allo-HSCT.
25091272 Tim-3/Gal-9 interaction favors apoptosis of MBP-specific T lymphocytes in benign multiple sclerosis; this process is reduced in PPMS by the up-regulation of Bat3
More...

AA Sequence

MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDK      1 - 70
KLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNL     71 - 140
PSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMETLPYLQCRGGPQPQHSQPPPQPPAVT    141 - 210
PEPVALSSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVL    211 - 280
QELQRLESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACT    281 - 350
PPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNV    351 - 420
ESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQ    421 - 490
QVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTP    491 - 560
GMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGSGVASP    561 - 630
TITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEF    631 - 700
FTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVML    701 - 770
LHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLE    771 - 840
FLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSL    841 - 910
VSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTA    911 - 980
EEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKR    981 - 1050
RKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQR   1051 - 1120
FPNAQRAFADDP                                                             1121 - 1132
//

Text Mined References (107)

PMID Year Title
26663859 2016 A conserved island of BAG6/Scythe is related to ubiquitin domains and participates in short hydrophobicity recognition.
26598275 2016 Chaperone BAG6 is dispensable for MHC class I antigen processing and presentation.
26153132 2015 Novel characterization of the HSPA2-stabilizing protein BAG6 in human spermatozoa.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25884493 2015 Association of the FAM46A gene VNTRs and BAG6 rs3117582 SNP with non small cell lung cancer (NSCLC) in Croatian and Norwegian populations.
25535373 2015 Bag6 complex contains a minimal tail-anchor-targeting module and a mock BAG domain.
25430685 2014 Effect of HLA-B-associated transcript 3 polymorphisms on lung cancer risk: a meta-analysis.
25416956 2014 A proteome-scale map of the human interactome network.
25415308 2014 Solution structure of the SGTA dimerisation domain and investigation of its interactions with the ubiquitin-like domains of BAG6 and UBL4A.
25231575 2015 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
More...