Property Summary

NCBI Gene PubMed Count 16
PubMed Score 7.75
PubTator Score 7.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung cancer 4473 2.14886301691603E-5
psoriasis 6685 7.1347293610487E-5
ovarian cancer 8492 1.58319460996997E-4
dermatomyositis 967 0.00221806524480827
Multiple myeloma 1328 0.0204018743725905
Disease Target Count Z-score Confidence
Alcohol dependence 107 3.017 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.278 0.020
psoriasis 1.600 0.000
lung cancer 1.600 0.000
ovarian cancer 2.200 0.000
dermatomyositis 1.100 0.002

Synonym

Accession P46199 D6W5D0 IF-2(Mt)
Symbols

Gene

  Ortholog (16)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
24166409 This study identified a novel GWS association (1.17 x 10(-10)) mapped to chromosome 2 at rs1437396, between MTIF2 and CCDC88A, across all of the EA and AA cohorts.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20468071 Observational study of gene-disease association. (HuGE Navigator)
19209188 Meta-analysis of gene-disease association. (HuGE Navigator)
18051367 HIV-1 NC downregulates mitochondrial translational initiation factor 2 in HEK 293T cells

AA Sequence

MNQKLLKLENLLRFHTIYRQLHSLCQRRALRQWRHGFSSAYPVWTAQLCAWPWPTDVLTGAALSQYRLLV      1 - 70
TKKEEGPWKSQLSSTKSKKVVEVWIGMTIEELARAMEKNTDYVYEALLNTDIDIDSLEADSHLDEVWIKE     71 - 140
VITKAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTPRSPVVTIMGHVDHGKTTLLDKFRKTQVAAVET    141 - 210
GGITQHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQ    211 - 280
VPIILAVNKCDKAEADPEKVKKELLAYDVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELKAD    281 - 350
PNGPVEGTVIESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKCWAKVRLMFDENGKTIDEAYPSMPVGITG    351 - 420
WRDLPSAGEEILEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKYGHLLWKKRS    421 - 490
ILRFLERKEQIPLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDASHECELELVHFGVGDVSAND    491 - 560
VNLAETFDGVIYGFNVNAGNVIQQSAAKKGVKIKLHKIIYRLVEDLQEELSSRLPCAVEEHPVGEASILA    561 - 630
TFSVTEGKKKVPVAGCRVQKGQLEKQKKFKLTRNGHVIWKGSLTSLKHHKDDISIVKTGMDCGLSLDEDN    631 - 700
MEFQVGDRIVCYEEKQIQAKTSWDPGF                                               701 - 727
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24166409 2014 Genome-wide association study of alcohol dependence:significant findings in African- and European-Americans including novel risk loci.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
19209188 2009 Genetic association analysis of 13 nuclear-encoded mitochondrial candidate genes with type II diabetes mellitus: the DAMAGE study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17416734 2007 The balance between protein synthesis and degradation in chloroplasts determines leaf variegation in Arabidopsis yellow variegated mutants.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...