Property Summary

NCBI Gene PubMed Count 137
Grant Count 84
R01 Count 58
Funding $5,826,910.43
PubMed Score 151.08
PubTator Score 140.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 0.005
ependymoma 1.300 0.016
oligodendroglioma 1.700 0.005
osteosarcoma 1.789 0.000
group 4 medulloblastoma 1.300 0.001
medulloblastoma, large-cell 1.500 0.000
ovarian cancer 2.400 0.000

Synonym

Accession P46109 A8KA44 D3DX35
Symbols

Gene

PDB

2BZX   2BZY   2DBK   2EO3   2LQN   2LQW  

Gene RIF (58)

PMID Text
26099693 The authors show that this potentiation involves reorganization of the natural CrkL-p85beta complex into a novel trimeric complex where influenza A virus NS1 serves as a bridging factor.
26079153 Our results demonstrate that the p53 target miR-200b/200c/429 miRNAs are negative regulators of the CRKL oncogene
26044596 CrkL mediates CCL20/CCR6-induced epithelial-to-mesenchymal transition via Akt pathway, instead of Erk1/2 pathway in development of gastric cancer
25658046 Haploinsufficiency of CRKL could be responsible for the etiology of conotruncal heart defects in individuals with nested distal deletions and might act as a genetic modifier of individuals with the typical 3 Mb deletion.
25636509 CrkL regulates CCL19 and CCR7-induced epithelial-to-mesenchymal transition via ERK signaling pathway in epithelial ovarian carcinoma patients.
25531052 CRKL has the potential to be used as a biomarker for the diagnosis, treatment and prognosis of certain tumors
25476480 these results suggest that CrkL plays a regulatory role in the SDF-1-induced Erk1/2 and PI3K/Akt pathways and further managed the invasion and migration of breast cancer cells
25405387 We identified ZEB1 and CRKL as potential targets of miR-429 by analyzing combined results from in silico search and global expression array of the same RNA samples. Immunoblot assay confirmed that miR-429 reduced their expression at protein level.
25318601 our study demonstrated that CRKL was overexpressed in human pancreatic cancers and contributed to pancreatic cancer cell proliferation and invasion through ERK signaling.
25307974 CrkL knockdown markedly suppressed the phosphorylated ERK (p-ERK) as well as the phosphorylated AKT (p-AKT) (p < 0.001) compared with control or TGF-b1 alone.
More...

AA Sequence

MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSHYIINSLPNRR      1 - 70
FKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE     71 - 140
DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEKLVRSSPHGKHGNRNSNSYGIPEPAHAYAQP    141 - 210
QTTTPLPAVSGSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVN    211 - 280
GRKGLFPFTHVKIFDPQNPDENE                                                   281 - 303
//

Text Mined References (143)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26099693 2015 Reorganization of the host cell Crk(L)-PI3 kinase signaling complex by the influenza A virus NS1 protein.
26079153 2015 CRKL oncogene is downregulated by p53 through miR-200s.
26044596 2015 CrkL meditates CCL20/CCR6-induced EMT in gastric cancer.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25658046 2015 Mouse and human CRKL is dosage sensitive for cardiac outflow tract formation.
25636509 2015 Crk-like adapter protein regulates CCL19/CCR7-mediated epithelial-to-mesenchymal transition via ERK signaling pathway in epithelial ovarian carcinomas.
25540073 2014 Integrative analysis of high-throughput RNAi screen data identifies the FER and CRKL tyrosine kinases as new regulators of the mitogenic ERK-dependent pathways in transformed cells.
25531052 2014 The role of CT10 regulation of kinase-like in cancer.
25476480 2015 CrkL regulates SDF-1-induced breast cancer biology through balancing Erk1/2 and PI3K/Akt pathways.
More...