Property Summary

NCBI Gene PubMed Count 193
PubMed Score 357.01
PubTator Score 232.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 2.400 2.6e-02
colon cancer -1.100 9.2e-03
non primary Sjogren syndrome sicca 1.200 2.7e-02
osteosarcoma 2.163 5.9e-07
ovarian cancer -1.600 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.185 1.8e-02
psoriasis -1.100 1.0e-02
tuberculosis -1.200 4.2e-05

Protein-protein Interaction (1)

Gene RIF (69)

AA Sequence

MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPP      1 - 70
VPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRAL     71 - 140
FDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHP    141 - 210
QPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECN    211 - 280
GKRGHFPFTHVRLLDQQNPDEDFS                                                  281 - 304
//

Text Mined References (207)

PMID Year Title