Property Summary

NCBI Gene PubMed Count 184
Grant Count 258
R01 Count 219
Funding $16,896,925.88
PubMed Score 335.46
PubTator Score 232.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.700 0.001
osteosarcoma 2.163 0.000
tuberculosis and treatment for 6 months -1.500 0.000
pancreatic ductal adenocarcinoma liver m... -1.185 0.018
colon cancer -1.100 0.009
Breast cancer 2.400 0.026
non primary Sjogren syndrome sicca 1.200 0.027
ovarian cancer 1.800 0.001

Synonym

Accession P46108 A8MWE8 B0LPE8 D3DTH6 Q96GA9 Q96HJ0
Symbols p38
CRKII

Gene

CRK

PDB

1JU5   2MS4   2DVJ   2EYV   2EYW   2EYX   2EYY   2EYZ  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
624303 other 0 / 0 / 26 Late stage assay provider assay for the probe development effort to identify inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl): Chemiluminescence-based biochemical kinase assay to identify inhibitors of Abl-mediated phosphorylation of purified CRK (powders ROUND 1)

Gene RIF (64)

PMID Text
26792730 CsA and FK506 might interfere with selected effector T cell functions via a CrkII-, but not CrkI-dependent mechanisms.
26473374 Crk Tyr251 phosphorylation regulate invasive cell phenotypes in glioblastoma.
26456136 in human c-CrkII, movement at position 239 and strain at position 272 are not tolerated because the beta-branched residues Ile239 and Val272 restrain the backbone mobility and thus destabilize the cis Pro238 form.
25956913 Studied the role of PAK1/Crk axis in transduction of the oncogenic KRAS signal in non-small cell lung cancer (NSCLC).
25816892 evidence uncovered essential roles of CRK in invasive bladder cancer through the hepatocyte growth factor/c-Met/CRK feedback loop for epithelial-mesenchymal transition induction
25506591 In this review, we describe the structure and function of the different Crk proteins.
25381819 Data indicate the role of tyrosine phosphorylation in regulating modular domain utilization in v-crk sarcoma virus CT10 oncogene homolog (avian) protein (Crk).
25284755 Data indicate that human proto-oncogene c-CrkII (CrkII) is regulated by phosphorylation only, but chicken CrkII is regulated by Pro238 trans-->cis isomerization and by Tyr222 phosphorylation.
25225668 The present data demonstrate that immunophilins regulate CrkII, but not CrkI activity in T cells and suggest that CsA and FK506 inhibit selected effector T cell functions via a CrkII-dependent mechanism.
24969300 Study indicates that miR-126 is a tumor suppressor that inhibits gastric cancer cells proliferation by targeting PI3KR2, Crk and PLK2.
More...

AA Sequence

MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPP      1 - 70
VPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSRSRQGSGVILRQEEAEYVRAL     71 - 140
FDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYRPASASVSALIGGNQEGSHP    141 - 210
QPLGGPEPGPYAQPSVNTPLPNLQNGPIYARVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECN    211 - 280
GKRGHFPFTHVRLLDQQNPDEDFS                                                  281 - 304
//

Text Mined References (199)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26792730 2016 In vivo regulation of human CrkII by cyclophilin A and FK506-binding protein.
26473374 2015 Reciprocal regulation of Abl kinase by Crk Y251 and Abi1 controls invasive phenotypes in glioblastoma.
26456136 2015 Long-Range Energetic Changes Triggered by a Proline Switch in the Signal Adapter Protein c-CrkII.
25956913 2015 Significance of KRAS/PAK1/Crk pathway in non-small cell lung cancer oncogenesis.
25816892 2015 Adaptor protein CRK induces epithelial-mesenchymal transition and metastasis of bladder cancer cells through HGF/c-Met feedback loop.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25506591 2014 Contribution of Crk adaptor proteins to host cell and bacteria interactions.
25416956 2014 A proteome-scale map of the human interactome network.
More...