Property Summary

NCBI Gene PubMed Count 153
PubMed Score 647.57
PubTator Score 279.49

Knowledge Summary


No data available


  Disease Sources (7)

Disease Target Count P-value
lung adenocarcinoma 2714 2.40739113901066E-6
ulcerative colitis 2087 7.63474776245666E-6
ovarian cancer 8492 2.26765480087273E-5
psoriasis 6685 6.18102732895845E-5
lung cancer 4473 7.64234061158183E-4
medulloblastoma, large-cell 6234 7.98223530913845E-4
diabetes mellitus 1663 0.00129427092684177
glioblastoma 5572 0.00344484403891867
Pick disease 1893 0.00405654921493918
hereditary spastic paraplegia 313 0.00821280332365365
astrocytic glioma 2241 0.00917653311836324
medulloblastoma 1524 0.0128281353666725
atypical teratoid / rhabdoid tumor 4369 0.0254945301715062
Rheumatoid Arthritis 1171 0.0288222706585245
Waldenstrons macroglobulinemia 765 0.0320204220938006
acute myeloid leukemia 785 0.0367505414389842
ependymoma 2514 0.0375751070533153
Disease Target Count Z-score Confidence
Breast cancer 3099 0.0 1.0
Carcinoma 2147 0.0 1.0
DOID:2627 14 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 6.265 3.1


  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 2.000 0.029
Waldenstrons macroglobulinemia 1.045 0.032
astrocytic glioma -1.900 0.009
ependymoma -1.400 0.038
psoriasis -2.100 0.000
atypical teratoid / rhabdoid tumor -1.400 0.025
glioblastoma -1.500 0.003
medulloblastoma -1.200 0.013
medulloblastoma, large-cell -1.600 0.001
hereditary spastic paraplegia -1.246 0.008
lung cancer 1.200 0.001
diabetes mellitus -1.400 0.001
acute myeloid leukemia 1.500 0.037
lung adenocarcinoma 1.197 0.000
Pick disease 1.200 0.004
ulcerative colitis 1.500 0.000
ovarian cancer 2.500 0.000


Accession P46100 D3DTE2 P51068 Q15886 Q59FB5 Q59H31 Q5H9A2 Q5JWI4 Q7Z2J1 Q9H0Z1 Q9NTS3
Symbols JMS



3QL9   3QLA   3QLC   4W5A   2JM1   2LBM   2LD1   3QLN  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (99)

27029610 ATRX interacts with ZNF274, TRIM28 and SETDB1 and binds to the 3' exons of zinc finger genes that present an atypical H3K9me3/H3K36me3 chromatin signature. Depletion of ATRX or ZNF274 leads to decreased H3K9me3 levels at zinc finger genes and other atypical chromatin regions.
26891131 Frequent ATRX mutations and aberrant ATRX gene expression in uterine leiomyosarcomas.
26773061 We provide an overview of the individual components (ATRX, DAXX and/or H3.3) tested in each study and propose a model where the ATRX/DAXX chaperone complex deposits H3.3 to maintain the H3K9me3 modification at heterochromatin throughout the genome.
26428317 Loss of ATRX was highly associated with alternative lengthening of telomeres
26395639 ATRX loss may predict better clinical outcome in astrocytoma patients with p53 overexpression as compared to patients with wild-type ATRX
26373281 In the absence of ATRX, the histone variant macroH2A1.1 binds to the poly(ADP-ribose) polymerase tankyrase 1.
26340527 Daxx and Atrx safeguard the genome by silencing repetitive elements when DNA methylation levels are low.
26210286 For WHO grade II diffuse glioma, molecular classification using 1p/19qcodel, IDHmut, and ATRX loss more accurately predicts outcome and should be incorporated in the neuropathologic evaluation.
26190196 Alternative lengthening of telomeres is an important telomere maintenance mechanism in primary angiosarcomas. This feature is highly associated with loss of ATRX expression and is frequently observed in hepatic angiosarcomas.
26143912 This study showed that expression of ectopic ATRX triggers a suppression of the pathway and telomere shortening.

AA Sequence

YQQIDMRGMYQPVAGGMQPPPLQRAPPPMRSKNPGPSQGKSM                               2451 - 2492

Text Mined References (172)

PMID Year Title
27029610 2016 ATRX binds to atypical chromatin domains at the 3' exons of zinc finger genes to preserve H3K9me3 enrichment.
26891131 2016 Exome Sequencing of Uterine Leiomyosarcomas Identifies Frequent Mutations in TP53, ATRX, and MED12.
26773061 2016 New players in heterochromatin silencing: histone variant H3.3 and the ATRX/DAXX chaperone.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26428317 2015 Comprehensive screening of alternative lengthening of telomeres phenotype and loss of ATRX expression in sarcomas.
26395639 2016 ATRX loss in adult supratentorial diffuse astrocytomas correlates with p53 over expression and IDH1 mutation and predicts better outcome in p53 accumulated patients.
26373281 2015 Loss of ATRX Suppresses Resolution of Telomere Cohesion to Control Recombination in ALT Cancer Cells.
26340527 2015 The Daxx/Atrx Complex Protects Tandem Repetitive Elements during DNA Hypomethylation by Promoting H3K9 Trimethylation.
26210286 2015 IDH mutation, 1p19q codeletion and ATRX loss in WHO grade II gliomas.
26190196 2015 Alternative lengthening of telomeres phenotype in malignant vascular tumors is highly associated with loss of ATRX expression and is frequently observed in hepatic angiosarcomas.