Property Summary

NCBI Gene PubMed Count 125
Grant Count 420
R01 Count 251
Funding $100,865,395.55
PubMed Score 2392.42
PubTator Score 283.54

Knowledge Summary

Patent (35,350)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 4.200 0.000
ovarian cancer 2.100 0.000

Synonym

Accession P46098 B4DSY6 G5E986 O60854 Q7KZM7 Q99918 Q9BSZ9 5-HT3-A
Symbols HTR3
5HT3R
5-HT-3
5-HT3A
5-HT3R

Gene

  TechDev Info (1)

Susumu Tomita Examining potential modulators

MLP Assay (16)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
More...

Gene RIF (119)

PMID Text
26843630 5-HT3A receptor distal targeting in axons and dendrites depends on P2X2R expression.
26768715 Alternative Viewpoint Against Breast Cancer Based on Selective Serotonin Receptors 5HTR3A and 5HTR2A Antagonists that can Mediate Apoptosis in MCF-7 Cell Line
26701104 A gene-environment interaction is revealed between childhood trauma and 5-htr3a polymorphisms.
26350166 Serotonin 3A receptor (5-HT3AR) is associated at the genetic and epigenetic levels with a variety of psychiatric disorders.
25989383 Agonist- and antagonist-induced up-regulation of surface 5-HT3 A receptors
25863270 Data indicate that no two n-alkanols act alike, their spectra of effects on serotonin receptor 3A (5-HT3A) receptors differ.
25339231 Our findings support the notion that different haplotypes of HTR3A have reciprocal effects in the etiology of Postoperative nausea.
24590108 variants in HTR3A, HTR3B, and SLC6A4 interactively contribute to etiology of alcohol, cocaine, and nicotine dependence
24338226 To conclude, considering 5-hydroxytryptamine 3A subtype receptor role in accomplishment of asthma symptoms, this increase in its expression may exacerbate the seriousness of asthma disease.
24304330 A significant increase in the relative expression level of 5-HT(3A) receptor in PBMCs.
More...

AA Sequence

MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAI      1 - 70
LNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYIR     71 - 140
HQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWE    141 - 210
LLGVLPYFREFSMESSNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITL    211 - 280
LLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLER    281 - 350
IAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ    351 - 420
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA                421 - 478
//

Text Mined References (128)

PMID Year Title
26843630 2016 A New Mechanism of Receptor Targeting by Interaction between Two Classes of Ligand-Gated Ion Channels.
26768715 2015 Alternative Viewpoint Against Breast Cancer Based on Selective Serotonin Receptors 5HTR3A and 5HTR2A Antagonists that can Mediate Apoptosis in MCF-7 Cell Line.
26701104 2015 Influence of the 5-HT3A Receptor Gene Polymorphism and Childhood Sexual Trauma on Central Serotonin Activity.
26350166 2016 METHYLATION OF SEROTONIN RECEPTOR 3A IN ADHD, BORDERLINE PERSONALITY, AND BIPOLAR DISORDERS: LINK WITH SEVERITY OF THE DISORDERS AND CHILDHOOD MALTREATMENT.
25989383 2015 Agonist- and antagonist-induced up-regulation of surface 5-HT3 A receptors.
25863270 2015 Fast and slow interactions of n-alkanols with human 5-HT3A receptors: Implications for anesthetic mechanisms.
25339231 2014 Sequence variants of the HTR3A gene contribute to the genetic prediction of postoperative nausea in Taiwan.
24590108 2014 Association and interaction analyses of 5-HT3 receptor and serotonin transporter genes with alcohol, cocaine, and nicotine dependence using the SAGE data.
24338226 2014 Significant changes of 5-Hydroxytriptamine 3A receptor gene expression in peripheral blood mononuclear cells of allergic asthmatic patients.
24304330 2013 Investigation of 5-HT3A receptor gene expression in peripheral blood mononuclear cells of individuals who had been exposed to air pollution.
More...