Property Summary

Ligand Count 412
NCBI Gene PubMed Count 133
PubMed Score 2426.70
PubTator Score 283.54

Knowledge Summary

Patent (35,350)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 2.100 7.8e-05
psoriasis 1.300 3.2e-07

Gene RIF (126)

AA Sequence

MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTVSIDVIVYAI      1 - 70
LNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYIR     71 - 140
HQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINISLWRLPEKVKSDRSVFMNQGEWE    141 - 210
LLGVLPYFREFSMESSNYYAEMKFYVVIRRRPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITL    211 - 280
LLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLER    281 - 350
IAWLLCLREQSTSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ    351 - 420
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA                421 - 478
//

Text Mined References (136)

PMID Year Title