Property Summary

NCBI Gene PubMed Count 9
PubMed Score 10.29
PubTator Score 7.44

Knowledge Summary

Patent (4,528)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.95577605048559E-6
atypical teratoid / rhabdoid tumor 4369 4.29407758982039E-5
medulloblastoma 1524 7.84280566382648E-5
glioblastoma 5572 7.92097763843372E-4
pilocytic astrocytoma 3086 0.00472778247318754
astrocytic glioma 2241 0.00941659952200428
oligodendroglioma 2849 0.0107277738551731
pituitary cancer 1972 0.0112728684212093
pediatric high grade glioma 2712 0.0121942318923256
primitive neuroectodermal tumor 3031 0.0163187682030603
ependymoma 2514 0.0180547782988426

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.000 0.009
ependymoma -2.100 0.018
oligodendroglioma -2.100 0.011
glioblastoma -2.300 0.001
osteosarcoma 1.402 0.000
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
primitive neuroectodermal tumor -2.100 0.016
pediatric high grade glioma -1.200 0.012
pilocytic astrocytoma -1.300 0.005
pituitary cancer 1.500 0.011

Synonym

Accession P46095 B4DHS9 J3KQR3 Q17RJ7 Q5SYL0
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

  TechDev Info (1)

Gene RIF (3)

PMID Text
22487033 The GPR6 gene influences the reinforcement learning rate in a computational, neurogenetic model.
20677014 Observational study of gene-disease association. (HuGE Navigator)
12649592 control of gene expression in vascular endothelial cells in the presence of fluid shear stress and determines that it is not a sphingosine 1-phosphate receptor

AA Sequence

MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLP      1 - 70
AVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETV     71 - 140
SLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCL    141 - 210
AERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGT    211 - 280
LAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQS    281 - 350
KVPFRSRSPSEV                                                              351 - 362
//

Text Mined References (13)

PMID Year Title
22487033 2012 How much of reinforcement learning is working memory, not reinforcement learning? A behavioral, computational, and neurogenetic analysis.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19286662 2009 Lipid G protein-coupled receptor ligand identification using beta-arrestin PathHunter assay.
19059244 2009 Constitutively active GPR6 is located in the intracellular compartments.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12649592 2003 Fluid shear stress differentially regulates gpr3, gpr6, and gpr12 expression in human umbilical vein endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...