Property Summary

NCBI Gene PubMed Count 9
PubMed Score 11.45
PubTator Score 7.44

Knowledge Summary

Patent (4,528)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.000 9.4e-03
Astrocytoma, Pilocytic -1.400 4.5e-03
atypical teratoid / rhabdoid tumor -2.300 4.3e-05
ependymoma -2.100 1.8e-02
glioblastoma -1.300 4.0e-04
group 4 medulloblastoma -1.400 4.9e-02
oligodendroglioma -2.100 1.1e-02
osteosarcoma 1.402 2.0e-06
pediatric high grade glioma -1.200 1.2e-02
pituitary cancer 1.500 1.1e-02
primitive neuroectodermal tumor -2.100 1.6e-02

Gene RIF (3)

AA Sequence

MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLP      1 - 70
AVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETV     71 - 140
SLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCL    141 - 210
AERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGT    211 - 280
LAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQS    281 - 350
KVPFRSRSPSEV                                                              351 - 362
//

Text Mined References (13)

PMID Year Title