Property Summary

Ligand Count 36
NCBI Gene PubMed Count 24
PubMed Score 46.91
PubTator Score 30.90

Knowledge Summary

Patent (8,390)

Expression

  Differential Expression (11)

Disease log2 FC p
facioscapulohumeral dystrophy 1.900 2.9e-02
interstitial cystitis 1.300 1.3e-04
intraductal papillary-mucinous adenoma (... -1.500 1.2e-03
intraductal papillary-mucinous carcinoma... -1.400 2.1e-03
intraductal papillary-mucinous neoplasm ... -1.400 2.3e-02
lung adenocarcinoma -1.300 1.7e-06
lung cancer -1.600 4.8e-04
medulloblastoma, large-cell -1.200 3.6e-05
osteosarcoma -3.000 1.1e-07
ovarian cancer 1.300 3.5e-09
psoriasis -2.200 2.3e-05

Gene RIF (16)

AA Sequence

MGNHTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLSIADLLYICTL      1 - 70
PLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVAVSSV     71 - 140
VWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAWMNLYRVFVGFLFPWALMLLSYRGILRAVRG    141 - 210
SVSTERQEKAKIKRLALSLIAIVLVCFAPYHVLLLSRSAIYLGRPWDCGFEERVFSAYHSSLAFTSLNCV    211 - 280
ADPILYCLVNEGARSDVAKALHNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAATPPSQG    281 - 350
DQVQLKMLPPAQ                                                              351 - 362
//

Text Mined References (27)

PMID Year Title