Property Summary

NCBI Gene PubMed Count 21
Grant Count 10
R01 Count 8
Funding $540,815.5
PubMed Score 43.80
PubTator Score 30.90

Knowledge Summary

Patent (8,390)

Expression

Gene RIF (13)

PMID Text
27078157 GPR4 induces angiogenesis via GPR4-induced p38-mediated IL6, IL8 and VEGFA secretion at acidic extracellular pH in squamous cell carcinoma of the head and neck
23888957 The results suggested that GPR4 may play an important role in the development of epithelial ovarian carcinoma (EOC), and its overexpression might be required for the angiogenesis, tumor growth, and metastasis of EOC
22110680 acidosis/GPR4 signaling regulates endothelial cell adhesion mainly through the G(s)/cAMP/Epac pathway
20211729 The mutation of histidine residue at 79, 165, or 269 from the N-terminal of GPR4 to phenylalanine shifted the half-maximal effective concentration (EC(50)) of proton-induced signaling activities to the right, including cAMP accumulation.
17462861 Previously postulated "ligand-independent" signaling of GPR4 is mediated through proton-sensing mechanisms.
17437524 lysophosphatidylcholine receptor G protein-coupled receptor 4 (GPK4) was expressed in YPEN-1 cells and triggered the cAMP/protein kinase A/cAMP response element-binding protein pathway, resulting in upregulation of adhesion molecules.
17364894 GPR4 in brain endothelial cells regulates monocyte transmigration.
16461426 GPR4 may play a critical role in the inflammatory responses activated by lysophosphatidylcholine
15857892 results identify sphingosylphosphorylcholine and its receptor, G protein-coupled receptor 4(GPR4), as critical regulators of the angiogenic potential of endothelial cells
15221007 GPR4 and TDAG8 overexpression in human tumors plays a role in driving or maintaining tumor formation
More...

AA Sequence

MGNHTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLSIADLLYICTL      1 - 70
PLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVAVSSV     71 - 140
VWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAWMNLYRVFVGFLFPWALMLLSYRGILRAVRG    141 - 210
SVSTERQEKAKIKRLALSLIAIVLVCFAPYHVLLLSRSAIYLGRPWDCGFEERVFSAYHSSLAFTSLNCV    211 - 280
ADPILYCLVNEGARSDVAKALHNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAATPPSQG    281 - 350
DQVQLKMLPPAQ                                                              351 - 362
//

Text Mined References (24)

PMID Year Title
27078157 2016 The Proton-Sensing G-Protein Coupled Receptor GPR4 Promotes Angiogenesis in Head and Neck Cancer.
23888957 2014 Relations between GPR4 expression, microvascular density (MVD) and clinical pathological characteristics of patients with epithelial ovarian carcinoma (EOC).
22110680 2011 Activation of GPR4 by acidosis increases endothelial cell adhesion through the cAMP/Epac pathway.
20211729 2010 Each one of certain histidine residues in G-protein-coupled receptor GPR4 is critical for extracellular proton-induced stimulation of multiple G-protein-signaling pathways.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17462861 2007 Previously postulated "ligand-independent" signaling of GPR4 is mediated through proton-sensing mechanisms.
17437524 2007 Upregulation of endothelial adhesion molecules by lysophosphatidylcholine. Involvement of G protein-coupled receptor GPR4.
17364894 A novel lysophospholipid- and pH-sensitive receptor, GPR4, in brain endothelial cells regulates monocyte transmigration.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16461426 2006 Lysophosphatidylcholine impairs endothelial barrier function through the G protein-coupled receptor GPR4.
More...