Property Summary

NCBI Gene PubMed Count 31
Grant Count 63
R01 Count 30
Funding $4,932,922.3
PubMed Score 15.41
PubTator Score 49.99

Knowledge Summary

Patent (13,640)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.700 0.000
interstitial cystitis 1.100 0.020

Synonym

Accession P46092 Q4V749 Q6T7X2 Q9NZG2 C-C CKR-10
Symbols GPR2

Gene

  TechDev Info (1)

Gene RIF (15)

PMID Text
25149529 The chemokine receptor CCR10 is highly expressed in human glioblastoma compared with control brain tissue.
24970722 Findings support the notion that CCR10 and its ligand CCL27 may contribute to the skin infiltration of malignant T-cells in mycosis fungoides and adult T-cell leukemia/lymphoma.
22944692 Positional proteomics analysis identifies the cleavage of human chemokine (C-C motif) receptor 10 (CCR10) at amino acid residues 326-327 by the HIV-1 protease
22526457 low CCL27/CCR10 and CXCL12/CXCR4 intratumoral mRNA ratios are associated with melanoma progression
22350183 CCR7 overexpression correlated with expression of metallothionein, while CCR10 was associated with cerebral metastases. CCR7 and CCR10 overexpressions were associated with a worse outcome independent of Breslow's tumor thickness and Clark level.
21937703 unlike blood plasmacytoid dendritic cells (pDCs), a subset of tonsil pDCs express functional CCR6 and CCR10, and their respective ligands CCL20 and CCL27 are detected in inflamed epithelia
21075690 The high fraction of circulating IgA+ and IgG+ B cells expressing CCR9 and CCR10 in the first months of life indicates activation of naive B cells in the gut, coinciding with bacterial colonization.
20947433 TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18782672 CCR4 and CCR10 are expressed on epidermal keratinocytes and that both are functional in terms of skin cytokine production and/or migration to their ligand CCL17 and CCL27, respectively.
More...

AA Sequence

MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNGLVLATHLAAR      1 - 70
RAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLYSASFHAGFLFLACISADRYV     71 - 140
AIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCRLIFPEGLTQTVKGASAVA    141 - 210
QVALGFALPLGVMVACYALLGRTLLAARGPERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARER    211 - 280
SCPASKRKDVALLVTSGLALARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCS    281 - 350
APTETHSLSWDN                                                              351 - 362
//

Text Mined References (31)

PMID Year Title
25149529 2014 Upregulation of chemokine receptor CCR10 is essential for glioma proliferation, invasion and patient survival.
24970722 2014 Microarray analysis of gene expression by microdissected epidermis and dermis in mycosis fungoides and adult T-cell leukemia/lymphoma.
22526457 2012 CCL27-CCR10 and CXCL12-CXCR4 chemokine ligand-receptor mRNA expression ratio: new predictive factors of tumor progression in cutaneous malignant melanoma.
22350183 2012 Overexpression of the chemokine receptors CXCR4, CCR7, CCR9, and CCR10 in human primary cutaneous melanoma: a potential prognostic value for CCR7 and CCR10?
21937703 2011 CCR6/CCR10-mediated plasmacytoid dendritic cell recruitment to inflamed epithelia after instruction in lymphoid tissues.
21075690 2011 Development of gut-homing receptors on circulating B cells during infancy.
20947433 2011 Toll-like receptor 2 induces mucosal homing receptor expression and IgA production by human B cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18782672 2008 CCR4 and CCR10 are expressed on epidermal keratinocytes and are involved in cutaneous immune reaction.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
More...