Property Summary

NCBI Gene PubMed Count 33
PubMed Score 15.58
PubTator Score 49.99

Knowledge Summary

Patent (13,640)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Status Epilepticus 98 0.0 0.0
Disease Target Count P-value
malignant mesothelioma 3232 9.0e-06
interstitial cystitis 2312 2.0e-02
Disease Target Count Z-score Confidence
Smith-Magenis syndrome 29 3.966 2.0
Allergic contact dermatitis 5 3.867 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis 1.100 2.0e-02
malignant mesothelioma 2.700 9.0e-06

Gene RIF (16)

AA Sequence

MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNGLVLATHLAAR      1 - 70
RAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLYSASFHAGFLFLACISADRYV     71 - 140
AIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFSQDGQREGQRRCRLIFPEGLTQTVKGASAVA    141 - 210
QVALGFALPLGVMVACYALLGRTLLAARGPERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARER    211 - 280
SCPASKRKDVALLVTSGLALARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCS    281 - 350
APTETHSLSWDN                                                              351 - 362
//

Text Mined References (33)

PMID Year Title