Property Summary

NCBI Gene PubMed Count 19
PubMed Score 35.30
PubTator Score 21.90

Knowledge Summary

Patent (6,753)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.7e-96
malignant mesothelioma 3163 8.2e-08
osteosarcoma 7933 8.8e-06
Disease Target Count Z-score Confidence
Human immunodeficiency virus infectious disease 129 3.298 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -4.600 8.2e-08
osteosarcoma 1.862 8.8e-06
psoriasis 1.800 1.7e-96

Gene RIF (9)

PMID Text
25391383 The Gene-based analyses revealed four significant associations in the WT1, ZC3H12C, DLGAP2, and GPR1 genes at p < 0.05. in this study.
22842622 Mesangial cells, an important component of the glomerulus, are susceptible to HIV-1 strains for which the viral gp120 protein uses GPR1 as a coreceptor
20385583 GPR1 gene is imprinted and paternally expressed in human and mouse.
20334567 identified homologous amino acid sequences in amino-terminal regions between CCR5 and GPR1/ sequences are important for G protein-coupled receptors to make the conformation critical for the interaction with the Env protein of HIV-1.
19343178 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16938805 Observational study of gene-disease association. (HuGE Navigator)
15919664 Data report that a synthetic peptide derived from the NH2-terminal extracellular region of an orphan GPCR, GPR1, inhibited infection of not only an HIV-1 variant that uses GPR1 as a co-receptor, but also X4, R5, and R5X4 viruses.
12837283 GPR1 is a senescence-associated gene in normal human oral keratinocytes.
10916084 Mesangial cells, an important component of the glomerulus, are susceptible to HIV-1 strains for which the viral gp120 protein uses GPR1 as a coreceptor

AA Sequence

MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKT      1 - 70
VTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLI     71 - 140
HPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVK    141 - 210
FIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHH    211 - 280
VMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCL    281 - 350
LETAQ                                                                     351 - 355
//

Text Mined References (21)

PMID Year Title
25391383 2015 Genetic variation in imprinted genes is associated with risk of late-onset Alzheimer's disease.
24955142 2014 Exploration of panviral proteome: high-throughput cloning and functional implications in virus-host interactions.
23764515 2013 Epigenetic and transcriptional features of the novel human imprinted lncRNA GPR1AS suggest it is a functional ortholog to mouse Zdbf2linc.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
20385583 2010 A tripartite paternally methylated region within the Gpr1-Zdbf2 imprinted domain on mouse chromosome 1 identified by meDIP-on-chip.
20334567 2010 Short communication: identification of the conformational requirement for the specificities of coreceptors for human and simian immunodeficiency viruses.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
18165312 2008 The genetic design of signaling cascades to record receptor activation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16938805 2006 G protein-coupled receptor for asthma susceptibility associates with respiratory distress syndrome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15919664 2005 The synthetic peptide derived from the NH2-terminal extracellular region of an orphan G protein-coupled receptor, GPR1, preferentially inhibits infection of X4 HIV-1.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12837283 2003 Senescence-associated genes in normal human oral keratinocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10233994 1999 An orphan G protein-coupled receptor, GPR1, acts as a coreceptor to allow replication of human immunodeficiency virus types 1 and 2 in brain-derived cells.
7851889 1994 Cloning of human genes encoding novel G protein-coupled receptors.