Property Summary

NCBI Gene PubMed Count 26
Grant Count 3
Funding $64,054
PubMed Score 28.24
PubTator Score 31.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 2.300 0.001

Synonym

Accession P46087 A1A4Z3 B3KPD6 Q05BA7 Q0P5S5 Q3KQS4 Q58F30
Symbols NOL1
p120
NSUN1
NOP120

Gene

Gene RIF (2)

PMID Text
26196125 p120 has an rRNA:5-Methylcytosine-Methyltransferase activity.
25481415 Findings suggest a newly discovered role of Nop2 in both mature neurons and in cells possibly involved in the regeneration of nervous tissue

AA Sequence

MGRKLDPTKEKRGPGRKARKQKGAETELVRFLPAVSDENSKRLSSRARKRAAKRRLGSVEAPKTNKSPEA      1 - 70
KPLPGKLPKGISAGAVQTAGKKGPQSLFNAPRGKKRPAPGSDEEEEEEDSEEDGMVNHGDLWGSEDDADT     71 - 140
VDDYGADSNSEDEEEGEALLPIERAARKQKAREAAAGIQWSEEETEDEEEEKEVTPESGPPKVEEADGGL    141 - 210
QINVDEEPFVLPPAGEMEQDAQAPDLQRVHKRIQDIVGILRDFGAQREEGRSRSEYLNRLKKDLAIYYSY    211 - 280
GDFLLGKLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYD    281 - 350
SSVPIGATPEYLAGHYMLQGASSMLPVMALAPQEHERILDMCCAPGGKTSYMAQLMKNTGVILANDANAE    351 - 420
RLKSVVGNLHRLGVTNTIISHYDGRQFPKVVGGFDRVLLDAPCSGTGVISKDPAVKTNKDEKDILRCAHL    421 - 490
QKELLLSAIDSVNATSKTGGYLVYCTCSITVEENEWVVDYALKKRNVRLVPTGLDFGQEGFTRFRERRFH    491 - 560
PSLRSTRRFYPHTHNMDGFFIAKFKKFSNSIPQSQTGNSETATPTNVDLPQVIPKSENSSQPAKKAKGAA    561 - 630
KTKQQLQKQQHPKKASFQKLNGISKGADSELSTVPSVTKTQASSSFQDSSQPAGKAEGIREPKVTGKLKQ    631 - 700
RSPKLQSSKKVAFLRQNAPPKGTDTQTPAVLSPSKTQATLKPKDHHQPLGRAKGVEKQQLPEQPFEKAAF    701 - 770
QKQNDTPKGPQPPTVSPIRSSRPPPAKRKKSQSRGNSQLLLS                                771 - 812
//

Text Mined References (42)

PMID Year Title
26196125 2015 Eukaryotic rRNA Modification by Yeast 5-Methylcytosine-Methyltransferases and Human Proliferation-Associated Antigen p120.
25481415 2015 Nop2 is expressed during proliferation of neural stem cells and in adult mouse and human brain.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
23913415 2013 Yeast Nop2 and Rcm1 methylate C2870 and C2278 of the 25S rRNA, respectively.
23848194 2013 Nucleolar scaffold protein, WDR46, determines the granular compartmental localization of nucleolin and DDX21.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...