Property Summary

NCBI Gene PubMed Count 66
PubMed Score 79.98
PubTator Score 82.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.275 2.9e-02
adult high grade glioma 1.800 1.0e-04
Astrocytoma, Pilocytic 1.200 1.8e-04
atypical teratoid / rhabdoid tumor 1.100 7.9e-04
diabetes mellitus -1.300 1.7e-03
ependymoma 1.100 3.2e-05
glioblastoma 1.300 1.5e-06
group 3 medulloblastoma 1.200 2.0e-02
juvenile dermatomyositis 1.206 7.4e-11
medulloblastoma, large-cell 1.100 7.8e-05
Multiple myeloma 1.246 4.9e-03
nasopharyngeal carcinoma 1.200 6.3e-04
ovarian cancer 1.400 6.4e-04
pancreatic ductal adenocarcinoma liver m... 1.269 1.0e-03
primary Sjogren syndrome 1.200 1.0e-03
primitive neuroectodermal tumor 1.100 6.4e-03
psoriasis -1.400 1.5e-04
Rheumatoid arthritis 1.600 2.1e-02
ulcerative colitis 1.700 2.0e-07
Waldenstrons macroglobulinemia -1.459 2.6e-02

Gene RIF (54)

AA Sequence

MASVSALTEELDSITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNK      1 - 70
EDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPL     71 - 140
ISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEA    141 - 210
RRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTAS    211 - 280
FNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEP    281 - 350
EDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGF    351 - 420
GDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNIT    421 - 490
EYCRDLIKILKQAEELNEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPREDLEKIIAHFLIQQYLKEDYS    491 - 560
FTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRAESSQTCHSEQGDKKMEEKNSGNFQKKAANM    561 - 630
LQQSGSKNTGAKKRKIDDA                                                       631 - 649
//

Text Mined References (73)

PMID Year Title