Property Summary

NCBI Gene PubMed Count 59
Grant Count 41
R01 Count 2
Funding $4,034,697.89
PubMed Score 76.55
PubTator Score 82.57

Knowledge Summary

Patent

No data available

Expression

Gene RIF (47)

PMID Text
26725729 RECQ1 A159C genotype may be a prognostic or predictive factor for resectable pancreatic cancer patients who are treated with adjuvant 5-FU before and after 5-FU-based chemoradiation.
26455304 To better understand the roles of RECQ1, two AL mutants (W227A and F231A) in full-length RECQ1 were characterized biochemically and genetically
26387136 RECQL is a DNA helicase in breast cancer [editorial]
26125302 RECQL is a new breast cancer susceptibility gene.
25945795 RECQL is a potential breast cancer susceptibility gene; mutations in this gene contribute to familial breast cancer development.
25915596 RECQL is a breast cancer susceptibility gene.
25831490 we show that RECQ1 can form what appears to be a flat, homotetrameric complex and propose that RECQ1 tetramers are involved in Holliday junction recognition
25483193 A novel function of RECQ1 is identified: in gene regulation and indicates that RECQ1 contributes to tumor development and progression, in part, by regulating the expression of key genes that promote cancer cell migration, invasion and metastasis.
25424877 RECQL1 is a prognostic factor for epithelial ovarian cancer and contributes to potential malignancy by inhibiting apoptosis.
25228686 our results provide first indication of nonredundant participation of WRN and RECQ1 in protection from the potentially carcinogenic effects
More...

AA Sequence

MASVSALTEELDSITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNK      1 - 70
EDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPL     71 - 140
ISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEA    141 - 210
RRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFPNASLIGLTATATNHVLTDAQKILCIEKCFTFTAS    211 - 280
FNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEP    281 - 350
EDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGF    351 - 420
GDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNIT    421 - 490
EYCRDLIKILKQAEELNEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPREDLEKIIAHFLIQQYLKEDYS    491 - 560
FTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRAESSQTCHSEQGDKKMEEKNSGNFQKKAANM    561 - 630
LQQSGSKNTGAKKRKIDDA                                                       631 - 649
//

Text Mined References (66)

PMID Year Title
26725729 2016 RECQ1 A159C Polymorphism Is Associated With Overall Survival of Patients With Resected Pancreatic Cancer: A Replication Study in NRG Oncology Radiation Therapy Oncology Group 9704.
26455304 2015 Catalytic strand separation by RECQ1 is required for RPA-mediated response to replication stress.
26387136 2015 RECQL: a DNA helicase in breast cancer.
26125302 2015 RECQL: a new breast cancer susceptibility gene.
25945795 2015 Mutations in RECQL Gene Are Associated with Predisposition to Breast Cancer.
25915596 2015 Germline RECQL mutations are associated with breast cancer susceptibility.
25831490 2015 Human RECQ1 helicase-driven DNA unwinding, annealing, and branch migration: insights from DNA complex structures.
25483193 2014 Identification of RECQ1-regulated transcriptome uncovers a role of RECQ1 in regulation of cancer cell migration and invasion.
25424877 2014 The level of RECQL1 expression is a prognostic factor for epithelial ovarian cancer.
25228686 Cellular deficiency of Werner syndrome protein or RECQ1 promotes genotoxic potential of hydroquinone and benzo[a]pyrene exposure.
More...