Property Summary

NCBI Gene PubMed Count 68
PubMed Score 65.66
PubTator Score 66.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Lymphoma, Large B-Cell, Diffuse 34 0.0 0.0
Disease Target Count
Diffuse large B-cell lymphoma 39
Disease Target Count P-value
non-small cell lung cancer 2890 1.6e-13
tuberculosis 2010 5.7e-09
psoriasis 6694 1.2e-04
Pick disease 1894 2.3e-04
subependymal giant cell astrocytoma 2287 4.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer 1.238 1.6e-13
Pick disease -1.100 2.3e-04
psoriasis 1.400 1.2e-04
subependymal giant cell astrocytoma -1.837 4.8e-02
tuberculosis -1.300 5.7e-09

Gene RIF (14)

AA Sequence

MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIA      1 - 70
KALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSA     71 - 140
CFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTL    141 - 210
EEVHMPQNGINHPGITALAQAFAVNPLLRVINLNDNTFTEKGAVAMAETLKTLRQVEVINFGDCLVRSKG    211 - 280
AVAIADAIRGGLPKLKELNLSFCEIKRDAALAVAEAMADKAELEKLDLNGNTLGEEGCEQLQEVLEGFNM    281 - 350
AKVLASLSDDEDEEEEEEGEEEEEEAEEEEEEDEEEEEEEEEEEEEEPQQRGQGEKSATPSRKILDPNTG    351 - 420
EPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAV    421 - 490
QDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLL    491 - 560
AFVTKPNSALESCSFARHSLLQTLYKV                                               561 - 587
//

Text Mined References (83)

PMID Year Title