Property Summary

NCBI Gene PubMed Count 78
Grant Count 82
R01 Count 54
Funding $10,535,735.83
PubMed Score 532.49
PubTator Score 359.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -2.000 0.000
intraductal papillary-mucinous adenoma (... -1.500 0.011

Synonym

Accession P46059 Q5VW82
Symbols PEPT1
HPECT1
HPEPT1

Gene

PANTHER Protein Class (1)

Gene RIF (63)

PMID Text
26979860 Data (including data from studies in transgenic/knockout mice) suggest human PEPT1 and mouse PepT1 exhibit different affinities for antibiotic cefadroxil; these differences may account for species differences in intestinal absorption of cefadroxil.
26811678 PEPT1 overexpression is associated with pancreatic cancer.
25931122 miRNA-193a-3p can target colonic PepT1 and reduce intestinal inflammation.
25531100 OSR1 has the capacity to downregulate the peptide transporters PEPT1 and PEPT2 by decreasing the carrier protein abundance in the cell membrane
25008848 Phe-Psi-Ala is a high-affinity, metabolically stable, non-radioactive probe for PEPT1.
24586284 Colonic miRNA expression/secretion, regulated by intestinal epithelial PepT1, could play a crucial role in cell-to-cell communication during colitis
24583477 The PEPT1 rs2297322 single-nucleotide polymorphism was not associated with inflammatory bowel disease susceptibility in our German cohort.
24380877 promoter constructs were generated and cotransfected with an Nrf2 expression plasmid
23993855 The induction of PEPT1 gene and the suppression of ABCG2 gene expression are among the key molecular mechanisms underlying tumor-specific PpIX accumulation after the administration of ALA in bladder cancer.
23959672 The present review summarizes the recent knowledge on the factors modulating PEPT1 expression/function in Caenorhabditis elegans, Danio rerio, Mus musculus and Homo sapiens, with focus on dietary ingredients, transcription factors and modulators.[review]
More...

AA Sequence

MGMSKSHSFFGYPLSIFFIVVNEFCERFSYYGMRAILILYFTNFISWDDNLSTAIYHTFVALCYLTPILG      1 - 70
ALIADSWLGKFKTIVSLSIVYTIGQAVTSVSSINDLTDHNHDGTPDSLPVHVVLSLIGLALIALGTGGIK     71 - 140
PCVSAFGGDQFEEGQEKQRNRFFSIFYLAINAGSLLSTIITPMLRVQQCGIHSKQACYPLAFGVPAALMA    141 - 210
VALIVFVLGSGMYKKFKPQGNIMGKVAKCIGFAIKNRFRHRSKAFPKREHWLDWAKEKYDERLISQIKMV    211 - 280
TRVMFLYIPLPMFWALFDQQGSRWTLQATTMSGKIGALEIQPDQMQTVNAILIVIMVPIFDAVLYPLIAK    281 - 350
CGFNFTSLKKMAVGMVLASMAFVVAAIVQVEIDKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGP    351 - 420
MSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRF    421 - 490
VNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQR    491 - 560
KNDSCPEVKVFEDISANTVNMALQIPQYFLLTCGEVVFSVTGLEFSYSQAPSNMKSVLQAGWLLTVAVGN    561 - 630
IIVLIVAGAGQFSKQWAEYILFAALLLVVCVIFAIMARFYTYINPAEIEAQFDEDEKKNRLEKSNPYFMS    631 - 700
GANSQKQM                                                                  701 - 708
//

Text Mined References (80)

PMID Year Title
26979860 2016 Species differences in the pharmacokinetics of cefadroxil as determined in wildtype and humanized PepT1 mice.
26811678 2016 A new target ligand Ser-Glu for PEPT1-overexpressing cancer imaging.
25931122 2015 MicroRNA-193a-3p Reduces Intestinal Inflammation in Response to Microbiota via Down-regulation of Colonic PepT1.
25531100 2014 Downregulation of peptide transporters PEPT1 and PEPT2 by oxidative stress responsive kinase OSR1.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25008848 2014 Evaluation of a thiodipeptide, L-phenylalanyl-?[CS-N]-L-alanine, as a novel probe for peptide transporter 1.
24586284 2014 Colonic miRNA expression/secretion, regulated by intestinal epithelial PepT1, plays an important role in cell-to-cell communication during colitis.
24583477 2014 Colonic expression of the peptide transporter PEPT1 is downregulated during intestinal inflammation and is not required for NOD2-dependent immune activation.
24380877 2014 Nrf2 regulates the expression of the peptide transporter PEPT1 in the human colon carcinoma cell line Caco-2.
23993855 2013 Expression levels of PEPT1 and ABCG2 play key roles in 5-aminolevulinic acid (ALA)-induced tumor-specific protoporphyrin IX (PpIX) accumulation in bladder cancer.
More...