Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.34
PubTator Score 11.82

Knowledge Summary

Patent (936)

Expression

  Differential Expression (10)

Disease log2 FC p
cystic fibrosis -1.200 3.2e-03
Duchenne muscular dystrophy -1.230 2.0e-05
group 3 medulloblastoma -1.500 8.6e-03
invasive ductal carcinoma 1.400 2.3e-03
lung cancer 1.100 2.5e-02
lung carcinoma 1.400 4.9e-18
malignant mesothelioma -4.000 1.9e-09
non-small cell lung cancer 1.199 5.8e-17
osteosarcoma -1.037 2.6e-02
subependymal giant cell astrocytoma 1.382 3.3e-02

 OMIM Phenotype (1)

Gene RIF (4)

AA Sequence

MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDED      1 - 70
KAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSV     71 - 140
YLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTADFGIWERGDKTNQGISELNASSVGMAKAALE    141 - 210
ALDELDLFGVKGGPQSVIHVLADEVQHCQSILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTK    211 - 280
QEIITKLQGRYGCCRFLRDGYKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQE    281 - 350
YKEALEAVLIKGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP    351 - 420
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILSHIYSSLGCNN    421 - 490
RMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIVEMLRTDLSYLCSRWRMTGQP    491 - 560
TITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQTGKLSEFLTTSCCTHLSFMDPGPEGKLYSE    561 - 630
DYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLM    631 - 700
SLVTKAKELHVQNVHMYLPTKLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQL    701 - 770
KETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL    771 - 840
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVYLAMYMRTQPG    841 - 910
LFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHHILSGKEFGVERSVRPTDSNV    911 - 980
SPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSISAESQSPGTSMTPSSGSFPSAYDQQSSKDSR    981 - 1050
QGQWQRRRRLDGALNRVPVGFYQKVWKVLQKCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQ   1051 - 1120
PEYRQLLVEAILVLTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYD   1121 - 1190
SAPSGRFGTMTYLSKAAATYVQEFLPHSICAMQ                                        1191 - 1223
//

Text Mined References (21)

PMID Year Title