Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.30
PubTator Score 11.82

Knowledge Summary

Patent (936)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -4.000 0.000
osteosarcoma -1.037 0.026
group 4 medulloblastoma -2.000 0.000
Duchenne muscular dystrophy -1.230 0.000
non-small cell lung cancer 1.199 0.000
lung cancer 1.500 0.006
cystic fibrosis -1.300 0.000
subependymal giant cell astrocytoma 2.204 0.003
lung carcinoma 1.400 0.000
invasive ductal carcinoma 1.400 0.002

Gene RIF (4)

PMID Text
22238410 muscle PHKA deficiency may present as an almost asymptomatic condition, despite a mild impairment of muscle
18401027 X-linked PHK deficiency causes a mild metabolic myopathy with blunted muscle glycogen breakdown and impaired lactate production during dynamic exercise, which impairs oxidative capacity only marginally
12876330 alpha- and beta-subunits possess amino-terminal glucoamylase-like domains and suggests that they might possess a previously overlooked amylase activity
1872871 The alpha subunit of phosphorylase kinase is preferentially cleaved at arg748-val749 by HIV-1 protease

AA Sequence

MRSRSNSGVRLDGYARLVQQTILCHQNPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDED      1 - 70
KAKAYELEQSVVKLMRGLLHCMIRQVDKVESFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSV     71 - 140
YLLFLAQMTASGLHIIHSLDEVNFIQNLVFYIEAAYKTADFGIWERGDKTNQGISELNASSVGMAKAALE    141 - 210
ALDELDLFGVKGGPQSVIHVLADEVQHCQSILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSQLVELTK    211 - 280
QEIITKLQGRYGCCRFLRDGYKTPKEDPNRLYYEPAELKLFENIECEWPLFWTYFILDGVFSGNAEQVQE    281 - 350
YKEALEAVLIKGKNGVPLLPELYSVPPDRVDEEYQNPHTVDRVPMGKLPHMWGQSLYILGSLMAEGFLAP    351 - 420
GEIDPLNRRFSTVPKPDVVVQVSILAETEEIKTILKDKGIYVETIAEVYPIRVQPARILSHIYSSLGCNN    421 - 490
RMKLSGRPYRHMGVLGTSKLYDIRKTIFTFTPQFIDQQQFYLALDNKMIVEMLRTDLSYLCSRWRMTGQP    491 - 560
TITFPISHSMLDEDGTSLNSSILAALRKMQDGYFGGARVQTGKLSEFLTTSCCTHLSFMDPGPEGKLYSE    561 - 630
DYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLM    631 - 700
SLVTKAKELHVQNVHMYLPTKLFQASRPSFNLLDSPHPRQENQVPSVRVEIHLPRDQSGEVDFKALVLQL    701 - 770
KETSSLQEQADILYMLYTMKGPDWNTELYNERSATVRELLTELYGKVGEIRHWGLIRYISGILRKKVEAL    771 - 840
DEACTDLLSHQKHLTVGLPPEPREKTISAPLPYEALTQLIDEASEGDMSISILTQEIMVYLAMYMRTQPG    841 - 910
LFAEMFRLRIGLIIQVMATELAHSLRCSAEEATEGLMNLSPSAMKNLLHHILSGKEFGVERSVRPTDSNV    911 - 980
SPAISIHEIGAVGATKTERTGIMQLKSEIKQVEFRRLSISAESQSPGTSMTPSSGSFPSAYDQQSSKDSR    981 - 1050
QGQWQRRRRLDGALNRVPVGFYQKVWKVLQKCHGLSVEGFVLPSSTTREMTPGEIKFSVHVESVLNRVPQ   1051 - 1120
PEYRQLLVEAILVLTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQKTLGADDTMLAKDPASGICTLLYD   1121 - 1190
SAPSGRFGTMTYLSKAAATYVQEFLPHSICAMQ                                        1191 - 1223
//

Text Mined References (21)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22238410 2012 Muscle phosphorylase kinase deficiency: a neutral metabolic variant or a disease?
21269460 2011 Initial characterization of the human central proteome.
20080404 2010 Muscle phosphorylase b kinase deficiency revisited.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18401027 2008 Is muscle glycogenolysis impaired in X-linked phosphorylase b kinase deficiency?
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...