Property Summary

NCBI Gene PubMed Count 549
PubMed Score 260.90
PubTator Score 211.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.411 2.2
Adenoma 165 3.324 1.7

Expression

  Differential Expression (29)

Disease log2 FC p
psoriasis 3.100 1.4e-04
malignant mesothelioma 1.600 2.6e-07
osteosarcoma -2.453 2.5e-03
posterior fossa group A ependymoma 1.800 3.5e-06
glioblastoma 3.200 1.6e-06
medulloblastoma 3.300 1.2e-10
atypical teratoid / rhabdoid tumor 3.100 8.8e-12
medulloblastoma, large-cell 3.900 7.1e-08
primitive neuroectodermal tumor 3.100 6.3e-06
Atopic dermatitis 2.000 1.7e-05
adrenocortical carcinoma 1.930 2.1e-03
pancreatic ductal adenocarcinoma liver m... 1.073 4.7e-02
non-small cell lung cancer 2.719 3.4e-30
intraductal papillary-mucinous adenoma (... 1.200 1.2e-02
intraductal papillary-mucinous carcinoma... 3.300 3.7e-05
intraductal papillary-mucinous neoplasm ... 3.800 7.1e-04
colon cancer 1.800 8.4e-04
lung cancer 5.300 1.4e-07
pancreatic cancer 1.200 5.4e-05
Breast cancer 3.600 2.5e-02
interstitial cystitis 1.200 1.1e-02
lung adenocarcinoma 1.400 3.4e-11
pediatric high grade glioma 2.600 1.0e-06
Endometriosis 1.670 3.4e-03
spina bifida 1.072 3.4e-02
ductal carcinoma in situ 1.800 3.5e-04
invasive ductal carcinoma 2.700 9.9e-05
ulcerative colitis 1.100 2.0e-04
ovarian cancer 1.800 1.5e-07

Gene RIF (521)

PMID Text
27363060 Ki-67 cell expression over 50% in CIN2 biopsies and high-grade squamous intraepithelial lesion (HSIL) in the previous cytology were statistically associated with CIN3 results in the cone
27362226 elucidation of a biomechanical role of the mitotic chromosome periphery in mammalian cells and suggests that Ki-67 can function as "surfactants" in intracellular compartmentalization
27276745 Ki-67 in tumor tissue is probably a more reliable marker than serum SCCA and CYFRA 21-1 in predicting the clinical course of esophageal squamous cell carcinoma
27197423 higher Ki-67 expression was related to the tumour invasiveness in pituitary adenomas.
27182675 Combination of Ki-67 expression and CT value determination was useful for the classification of differentiation and metastatic or proliferative potential of peripheral lung adenocarcinoma.
27012044 High Ki67 expression was frequently observed in resected T3 gastric adenocarcinoma and was a significant prognostic factor for poor outcome.
26978017 The simultaneous determination of the chemokine receptor CXCR4 and proliferative activity (Ki-67 expression) can define disease prognosis in view of relapse-survival rates in patients with Stage II colon cancer after radical surgical treatment
26964379 The expression of Ki-67 protein is associated with the expression of p53 protein in pterygium.
26963620 Infiltrating Lobular Breast Carcinoma of non-lactating women showed a larger (p = 0.009), lymph node involvement (p = 0.051) and distant metastasis (p = 0.060). They were also more proliferative tumors measured by Ki-67.
26954364 Ki-67 expression showed a substantial concordance between biopsy and surgical specimens. Extremely discordant Ki-67 levels may be associated with aggressive tumor biology.
26926679 Using the Ki-67 index is superior to using cytology and growth pattern as prognostic factors in Mantle-cell lymphoma.
26911364 High Ki-67 LI were associated with retroperitoneal soft tissue sarcomas.
26818835 Analysis revealed linearly independent intrinsic factors of the Ki67 immunohistochemistry variance: proliferation
26786263 The use of basal Ki67 status as a predictive factor of chemotherapy benefit could facilitate the identification of a patient subpopulation with high probability of achieving pathological complete response when treated with primary chemotherapy, and thus with a potentially favorable long-term prognosis.
26743291 The investigation of p53 and Ki-67 expression is useful in identifying highly proliferative forms of salivary tumors, with aggressive potential of evolution.
26743285 the markers Ets-1 and APAF-1 relative to p53, Ki-67 and PTEN expression in colon adenomas/polyps, were investigated.
26722504 These results indicated there might be a tight correlation among MTA2, Ki-67 and hepatocellular carcinoma prognosis
26708185 correlation between TGFb1 and pSmad2 as well as between HtrA1 and TGFb1 and the very significant increase of Ki67 in stromal compartment of eutopic endometrium suggest a possible involvement of HtrA1 in the pathogenesis of endometriosis.
26633571 Genomic Grade Index or centrally reviewed Ki67 significantly improves clinicopathological models to determine distant recurrence of breast cancer.
26619927 Ki-67 index >/= 4% was found significantly associated with the survival of solid pseudopapillary tumor of the pancreas.
26593398 EZH2 is highly expressed in pituitary adenomas, positively associated with Ki-67 expression, and associated with proliferation.
26546525 oligonucleotide-mediated treatment could be more effective when directed towards KI-67 and BCL2. This could be accomplished by dual monospecific targeting KI-67 and BCL2
26512778 Findings indicate that high Ki67 antigen/ SATB1 protein ratio was an independent predictor of worse overall survival (OS), while Ki67 and SATB1 did not reach statistical significance as single predictors.
26472563 we propose that PELP1/Ki-67 double high expression in tumors is an independent prognostic factor for predicting a poor outcome for patients with Triple-negative breast cancer
26459875 High-grade cell proliferation, as measured by Ki-67 labeling index, significantly correlated with an tumor infiltration pattern that indicated a more aggressive lung squamous cell carcinoma.
26458958 We observed an association of higher Ki-67 expression with Gleason sum National Comprehensive Cancer Network risk (P=0.013) and PSA recurrence
26456310 High expression of Ki-67 is associated with a higher tumor grade and higher mortality.
26448927 Ki-67 Expression in CRC Lymph Node Metastasis Does Not Predict Survival.
26423666 COX-2 and Ki-67 are abundantly expressed in hepatolithiasis and bile duct carcinoma tissues and may play an important role in the disease occurrence, progression, and metastasis
26420767 Tissue handling of surgical specimen is critical for assessing the Ki-67 index in surgical removed breast cancer.
26345794 The expression of Ki67 and FasL is closely related to the occurrence and development of cervical carcinoma.
26338964 Classification based on IDH1/2 mutation status and Ki-67 expression level could be more convenient for clinical application and guide personalized treatment in malignant gliomas.
26317313 Her2 and Ki67 expression predicts recurrence of ductal carcinoma in situ.
26281861 High Ki67 expression in colorectal cancer is associated with good clinical outcome.
26261629 Suggest that combination of Bcl-2 and Ki67 to detect gastric cancer is more effective.
26241661 Overexpression of p53 and Ki-67 could be used to discriminate low-risk luminal A subtype in breast cancer.
26230097 Both p16/Ki-67 double staining and the hr-HPV DNA test had similar performance in predicting high-grade cervical intraepithelial neoplasia among women with ASC-US
26214624 Suggest that clinical course of KI67/Her2 positive breast cancer was determined by hormone receptor status rather than Ki67 expression.
26206765 Region of interest size is a critically important parameter for semiautomated Ki67 quantification by computer-assisted image analysis in breast cancer.
26188382 Data suggest that tumor expression of Ki67 and GRIM19 (cell death-regulatory protein GRIM19) correlate with malignancy in thyroid Hurthle cell (HC) tumors; variable expression of Ki67 and GRIM19 may helped differentiate HC carcinoma from HC adenoma.
26174366 elevated Ki-67 expression was associated with a poorer outcome in NSCLC patients, particularly in early-stage Asian ADC patients.
26171918 Suggest MIB-1 index may be used as a surrogate for the mitosis-karyorrhexis index in neuroblastoma.
26107196 High ki-67 expression is associated with poor Response to chemotherapy in Patients with Nasal Natural Killer/T-cell Lymphoma.
26078569 Suggest that Ki67 expression correlates with prognosis in gastrointestinal stromal tumors.
26076967 AR is not associated with the proliferation marker Ki-67, but is associated with lower 21-gene recurrence score in estrogen receptor positive/HER2 negative breast cancer.
26070608 Suggest Ki-67 proliferative index as an important prognostic factor of biochemical recurrence and death in prostate cancer post prostatectomy.
26060263 Ki67 expression varied in breast cancer patients according to menstrual cycle phase.
26039245 Univariate analyses showed that AR, CDH1 and Ki-67 expression levels were significantly associated with overall survival in triple-negative breast cancer patients.
26017881 Evaluating p16 and Ki-67 in combination would be significant in predicting recurrence in pTa and pT1 urothelial carcinomas.
26017878 Ki-67 index is a useful parameter for more objective grading and can be of prognostic value to determine the biological potential of preneoplastic bronchial lesions.
25967708 Treg cell level was related to Ki-67 expression and immune status in non-small cell lung cancer patients.
25932921 Visual assessment of Ki67 labeling index at 10 % intervals is a candidate for a standard method in breast cancer clinical practice.
25879558 It was indicated, that index of maturation correlates with level of bone marrow cells, containing Philadelphia chromosome, so as with percentage of CD34+, Bcl-2+, Pgp-170+ and Ki67+ cells in bone marrow of CML patients.
25863475 Among women with SA, increased Ki-67 expression in either the SA lesion or the normal background terminal duct lobular units carried an approximately twofold increased odds of subsequent breast cancer as compared to lower Ki-67 expression.
25845386 negative-ER ,negative-PR ,positive-p53 and higher Ki-67 expressions were related to a higher mtDNA copy ratio. In addition, advanced T-status (p=0.019) and negative-HER-2/neu expression (p=0.061) were associated with mtDNA D310 mutations
25835106 There was a statistically significant difference between well-differentiated endocrine neoplasm (Grade I), and well-differentiated endocrine carcinoma (WDEC, Grade II) and PDEC for Ki-67 >20% (p<0.001).
25807305 Ki-67/MIB-1 had a prognostic value for overall survival in cervical cancer patients.
25790540 Studied the prognostic value of Ki-67, p27, and p53 immunoreactivity in human gastric cancer.
25778295 Neoadjuvant chemotherapy reduces Ki67 expression in breast cancer patients.
25777091 High KI-67 antigen expression is associated with Malignant Peritoneal Mesothelioma.
25743839 High expression of ki67 is associated with papillary thyroid microcarcinoma.
25712457 Ki-67 is a strong predictor of central nervous system relapse in patients with mantle cell lymphoma.
25711229 Immunohistochemistry analysis shows that co-expression of p16, Ki-67 and COX-2 is associated with basal phenotype in high-grade ductal carcinoma in situ of the breast.
25684532 High Ki-67 expression is associated with recurrence in invasive ductal breast cancer.
25684464 High Ki-67 expression is associated with glioma.
25673730 Visual assessment of Ki67 in breast neoplasms by a 5-grade scale (Eye-5) is fast, easy, and reliable with acceptably low interobserver and intraobserver variability.
25657202 In ACC, the proliferation marker Ki-67 was associated with significantly poorer overall and disease-free survival.
25648135 The combined Ki67/Bcl2 phenotyping was useful in luminal cancers prognostication. It also refined prognostication in intermediate groups (grade 2 and stage 2 cancers) of luminal cancers; and aided in further classification of luminal A cancers.
25633038 Results show that patients with Ki67 higher than median had significantly shorter median overall survival than those with low Ki67 suggesting its prognostic value in epithelioid malignant pleural mesothelioma.
25631074 Cellular biotinylated marker of proliferation Ki-67 (MKI67) protein is incorporated into HIV-1 Gag virus-like particles
25600243 Ki-67 and PgR expression were independently associated with the prognosis of patients with ER+ and HER2- breast cancer
25595275 Elevated Ki67 and geminin expression distinguish a fraction of metastatic breast carcinoma with worse prognosis.
25573205 The present study shows that high Ki-67 LI is a risk factor for poor OS in the late-elderly age group and non-GCB subtype in patients with DLBCL treated with R-CHOP.
25556461 No associations were found between Ki67 expression and histological grade in breast neoplasms.
25547827 High Ki-67 expression is associated with hypopharyngeal cancers.
25527409 High Ki-67 expression is associated with prostate carcinomas.
25511212 increased expression of Cyclin D1 and Ki-67 in patients with endometrial carcinoma relative to proliferative endometrium and simple hyperplasia,.. Cyclin D1 expression had a positive correlation with Ki-67 expression.
25504496 We found that Ki-67 expression in pathologic BM is a novel significant prognostic parameter of worse prognosis in DLBCL patients with BMI in the rituximab era.
25431344 Computerized image analysis of the Ki-67 index in MCL is an attractive alternative to semiquantitative estimation and can be introduced easily in a routine diagnostic setting for risk stratification in MCL.
25404475 High Ki67 Expression is associated with Oropharyngeal Squamous Cell Carcinoma.
25400769 Suggest that Ki67 expression in HR-negative breast cancer may improve the assessment of pathological response after neoadjuvant chemotherapy.
25398292 -67 proliferation index levels were higher in patients with legal abortions than patients with placenta percreta or noncomplicated cesarean delivery group.
25384521 it is not possible to relate the increased Ki67 index of villous trophoblasts in the last trimester in preeclampsia with one cause
25381338 Circulating tumor cells expression of ER, BCL-2, HER2, and Ki67 can be reproducibly measured with high analytical validity using the CellSearch System.
25374203 Ki67 index is a valuable IHC marker to distinguish indolent from aggressive lymphomas especially in small needle biopsies where exact typing may not be possible.
25339008 High Ki-67 expression is associated with gastric cancer.
25313763 No significant association was observed between Ki-67 expression and Breslow tumor thickness, Clark level, or lymph node involvement.
25313753 This study demonstrates that, Ki-67 LI serves as an important prognostic marker in human astrocytomas.
25308006 The results emphasize the potential of Ki-67 and p53 as biomarkers of carcinogenesis in oral squamous cell carcinoma.
25297929 Ki67 was highly expressed in five cases of primary mucosal malignant melanoma, while the expression in the other five cases was low. There was no correlation between the Ki67 expression and prognosis.
25211928 an association between the vimentin and ki-67 expression levels and the degree of spread of metastatic renal cell carcinoma was identified: the high level of expression of these markers precludes the increase of life expectancy
25204411 Our data showed that Ki-67 is an effective prognostic indicator of survival in ENKTL patients. This prognostic index may be helpful in identifying high-risk patients with ENKTL.
25195708 Data suggest Ki-67 labeling index (immunochemical detection of MKI67) is the most useful prognostic marker for thyroid follicular cell tumors and is a reliable, objective parameter to stratify patient prognosis postoperatively. [REVIEW]
25170613 In this study, PR negativity was a prognostic factor for early relapse in luminal B/HER2-negative breast cancer, while a high Ki-67 index suggested a higher risk of early relapse.
25149503 In uterine cervical lesions, Ki-67 expression was observed in high grades CIN and carcinoma
25120774 elevated protein expression of p53, cyclin D1 and Ki-67 in the second primary malignancy is an indicator of more aggressive malignant behavior of the secondary tumor
25088936 In multiple pathology specimens of primary neuroendorine tumors and their metastases, Ki67 expression varied over the course of the disease.
25029119 Ki-67 may be a useful diagnostic adjunct in irradiated breast
25016269 high Ki-67 labeling index is predictive sign of a poor prognosis in women with resistant prolactinoma.
25015333 Expression of miR-34a was lower in metastases than in primary tumors. It inversely correlated with expression of cyclin D1 and Ki-67
25013792 this is a first study showing the correlation of Ki-67, PCNA interacted with CDK1 might lead to malignant transformation.
25012947 Letter: report diagnostic role of Ki67 immunohistochemistry in hyalinizing trabecular tumor of the thyroid.
25012651 Although no obvious defects in the progression of mitosis were observed, the timing of dephosphorylation of the mutant Ki67 in anaphase was delayed, indicating that Ki67 itself is one of the substrates of PP1gamma-Ki67.
25003838 Ki-67 may be a useful marker for discriminating benign from borderline PTs, and p16 and pRb may be a useful combination of markers for distinguishing FA from benign PTs in core biopsy specimen.
24966950 Notch-1 and Ki-67 expression may act as promising predictors for the recurrence and prognosis of Kimura's disease.
24966939 Ki67 index is an effective complementation of modified NIH criteria in predicting the prognosis of gastrintestinal stromal tumors, and Ki67 index>8% may act as an unfavorable factor for imatinib adjuvant therapy.
24949917 The level of Ki-67 may be considered one of the valuable biomarkers in breast cancer patients with respect to process and recurrence.
24934660 Report counting strategy which acknowledges small highly proliferative hot spots of Ki67 expression in breast neoplasms.
24929480 High Ki-67 expression is associated with dysplastic areas of large gastric hyperplastic polyps.
24870756 In triple negative breast cancer, Ki67 expression was correlated with spiculated margin and intensive posterior echo with spotty flow imaging by ultrasound.
24867636 Ki-67 is a protein phosphatase 1-interacting protein that organises the mitotic chromosome periphery.
24852133 PCNA and Ki67 staining intensities significantly increased in villous parts, significantly decreased in basal plates of Preeclampsia group
24834759 Basal cell carcinoma exhibited a wide variation of Ki67 proliferative indices, ranging from 1% to 61%, among the histological subtypes
24815448 Ki-67 was expressed in 13 (65%) tumors, and negatively correlated with age, prognosis, histologic type and stage of Neuroblastoma
24785530 confirms that the deregulated cell cycle, as demonstrated by p16/Ki-67 dual labelling, is independent of the oncogenic action of hr-papillomaviruses in high-grade urothelial proliferations
24783217 data shows that the Ki-67 value predicts the response to neoadjuvant chemotherapy as a function of the molecular subtype
24750272 This study attests the reproducibility of Ki67-LI of pNETs whether counted on cytology or histology with a very good inter-observer correlation
24717877 The significant positive correlations were observed between Bcl-2 protein and Ki-67 antigen in sinonasal inverted papilloma and sinonasal carcinoma groups and between Bcl-2 protein and CD34 antigen in the chronic rhinosinusitis group.
24715164 Establishment of Ki67, p53 and CD34 expression in human tooth buds of different stages of odontogenetic development.
24708745 Data provide methodology to achieve accurate immunohistochemical Ki67 labelling index (Ki67 LI) reflects proliferative activity estimation by the digital image analysis (DIA) approach.
24642606 p16/Ki-67 dual-stained cytology may provide a valuable novel approach to identify pregnant women with persistent or progressing cervical intraepithelial neoplasia disease
24627004 Ki-67 is an independent prognostic marker for patients with epithelial ovarian carcinoma
24624938 It has found a statistically significant correlation between the expression of ki67 markers and WHO grade and recurrence.
24610618 Ki67 expression increases in gliomas.
24597851 the prognostic significance of Ki-67 expression varied in different subtypes of lymphoma and in DLBCL and MCL after the introduction of rituximab, which was valuable for clinical decision-making and individual prognostic evaluation.
24586570 Data observed that MIB-1 is a reliable independent prognostic indicator for ER negative infiltrating ductal carcinoma in this study.
24585679 Investigated expression of a pathological biomarker, Ki-67, in addition to studying the usefulness of (18)F-FDG PET-CT in the pretreatment evaluation of thymic epithelial neoplasms.
24577133 Ki67 index, MVD and HIF-1 alpha index have promising prognostic value in BM and should be validated in further studies.
24553861 Ki-67 overexpression suggests that cytotoxic agents are effective for SDC.
24507671 Expression of beta-catenin, Ki67 and Her-2/Neu was studied in gastric cancer. The protein expression of beta-catenin, Ki67 and Her-2/Neu had close relationship with the clinical pathologic characteristics of gastric cancer.
24505696 The automatic Ki-67 score is very accurate compared with pathologists' estimation.
24498305 Data suggest that Ki-67 status was an independent prognostic factor for metastasis free survival (MFS) and overall survival in breast cancer patients with 1-3 positive nodes.
24486077 Each 1% increase in Ki-67 expression was associated with a 12% increased risk of prostate cancer-specific death.
24452592 In residual pituitary adenomas with a Ki-67 Li above 2.2%, regrowth should be expected, and these tumors may require shorter intervals of follow-up magnetic resonance imaging (MRI) and/or early adjuvant therapy.
24403473 High Ki-67 expression is associated with breast cancer.
24403472 High Ki-67 expression is associated with breast cancer.
24403187 Ki67 immunostaining provides prognostic information beyond traditionally assessed clinicopathological variables in node-negative breast cancer.
24384677 It is a tumor marker for proliferation and invasion.
24373696 importance of temporal-spatial expression of Ki-67 for the thickening of the cranial spinal cord lateral wall
24369532 CISH would help to distinguish episomal from integrated HPV, in order to allow conclusions regarding the prognosis of the lesion, while p16(INK4a)/Ki67 dual stain approach would confer a high level of standardization to the diagnostic procedure
24360660 Data indicate that Ki-67 positivity is prognostic for predicting non-muscle invasive bladder cancer (NMIBC) recurrence and progression.
24356306 Cellular biotinylated marker of proliferation Ki-67 (MKI67) protein is incorporated into HIV-1 Gag virus-like particles
24344040 KB cell Ki-67 mRNA significantly increased after doxorubicin treatment.
24344030 Significant relationship between Ki-67 proliferation index and CDC25B staining index in astrocytomas.
24324728 The aim of the present study was to evaluate the prognostic value of the proliferation factors mitotic activity index (MAI), phosphohistone H3 (PPH3), cyclin B1, cyclin A and Ki67, alone and in combinations.
24322019 Immunofluorescence expression (IFE) of cell cycle regulators p16ink4a, p21, p27, in association with Ki-67, p53 in cell cultures, obtained from different types of cervical intra-epithelial lesions, was assessed.
24261348 HPV genotyping, p16/Ki-67 dual staining and koilocytic morphology can be useful in the prediction of clinical outcome in women initially diagnosed with low-grade squamous intraepithelial lesion cytology.
24207090 High Ki67 expression is predictive of poor prognosis and of resistance to adjuvant tamoxifen therapy in postmenopausal BC. We recommend considering Ki67 as one of the risk factors that guide adjuvant treatment decisions.
24200480 Apparent diffusion coefficient values of prostate cancer could reflect tumor proliferative activity and differentiated degree of prostate cancer.
24196303 Ki-67 and p53 expression varies in morphologically normal tubal epithelial cells depending on age and BRCA1 mutation status.
24189270 Studied cohort of breast cancer patients that received neoadjuvant therapy between 2002 and 2010. Ki-67 expression was measured using quantitative immunofluorescence automated quantitative analysis (AQUA) technology.
24185119 The imunohistochemical staining for topoisomerase IIalpha expression might be useful as additional marker for mucosal dysplasia degree determination
24151431 p16(INK4a)/Ki-67 and L1 capsid protein immunostaining and HR-HPV testing of residual LBCS diagnosed with ASC-H or LSIL-H are useful objective biomarkers for predicting CIN2+.
24121170 Suggest that Ki67 labeling be performed on all pancreatic neuroendocrine tumors in addition to mitotic rate determination to define more accurately tumor grade and prognosis.
24118263 The integration of the immunocytochemical score of Ki-67 and p53 into the cytological score resulted in a final score that was also diagnostically useful.
24083750 High Ki-67 expression is associated with uterine cervical neoplasms.
24081504 p16/Ki-67 immunostaining demonstrated better accuracy than human papillomavirus for detecting cervical intraepithelial neoplasia 2 or higher in patients with atypical squamous cells
24061459 A significant positive correlation was found between age and PCNA and MIB-1 values (P < 0.05) when comparison was made for all the cases
24056649 Ki-67 and p53 expression rates were statistically significantly correlated with grade of mammary phyllodes tumors.
24051696 Ki67 index, TP53 status, or PR negativity can be used to segregate ER-positive, HER2-negative tumors into prognostically meaningful subgroups with significantly different clinical outcomes.
24024498 Tonsil surface epithelium is a useful control for monitoring Ki-67 staining. Achieving optimal staining results could minimize variations in Ki-67 index due to differences in the staining methods used by different laboratories.
24021213 Ki-67 staining is stronger than PHH3, making 'hot spots' easier to identify on ACIS. Ki-67 is more ideal than PHH3( Phosphohistone H3 ) for staining NENs, especially in tumors with borderline grades.
24008660 in oral squamous cell carcinoma cohort, below-median Ki67 and top-quartile sCAIX expression (Ki67(lo)sCAIX(hi)) were associated with significantly worse disease-specific survival in univariate and multivariate analyses
23986211 Report Ki67 expression in gastrointestinal stromal tumors.
23982330 We demonstrate that axillary lymph node involvement and high expression of Ki-67 are associated with poorer prognosis.
23970015 Ki67 was significantly linked to prognosis in uni- and multivariate analysis in the complete cohort and in HR-positive, but not triple-negative breast cancer
23963898 cell cycle related proteins PCNA, Ki67, cyclin D3, p27 and p57 were expressed in both normal and diabetic human term placentas.
23902708 MIB-1 is an important clinical marker in astrocytomas. Nevertheless, several shortcomings make it difficult to standardize a proliferation index for prognostic purposes.
23846734 Ki-67 overexpression was detected in the epithelial component in 15 out of 36 (42%) Carcinosarcoma cases, and in the mesenchymal component in 13 out of 36 (36%) Carcinosarcoma neoplasms.
23818355 Expression of Ki67 was correlated with grade and stage in bladder cancer.
23818347 Ki67 levels were altered after neoadjuvant chemotherapy in breast cancer.
23818346 Immunohistochemical expression of Ki67 was not associated with characteristics of invasive breast cancers.
23818345 Report prognostic value of Ki-67 determination in fine needle aspirates of breast tumors.
23812670 Posttreatment Ki67 levels provide prognostic information for patients with hormone-receptor-positive breast cancer and residual disease after neoadjuvant chemotherapy.
23805466 Ki-67 and matrix metalloproteinase-9 expression in the follicular cyst, keratocystic odontogenic tumor, and ameloblastoma
23790165 Ki-67 and p53 might have influence on meningioma development and progression
23729443 Through phenotype analysis, non-hepatitis A virus-specific antibody-secreting cells (ASCs) are found to be Ki-67lowCD138highCD31highCD38high compared with hepatitis A virus-specific ASCs.
23729350 Using Ki-67, Bcl-2, p53, and Cox-2 markers, we managed to distinguish fully disordered proliferative/benign hyperplastic endometrium endometrium from low-grade endometrial carcinoma.
23721782 In HMG tissues, Ki-67-positive cells were scattered in both the gray and white matter, with a significantly higher Ki-67 labeling index in the white matter compared with gray matter.
23718721 p53 and Ki-67 markers are associated with cell proliferation in children with Eosinophilic esophagitis but do not represent a premalignant (dysplastic) condition of the esophagus
23674848 Carbonic anhydrase II and Ki-67 are significant prognostic factors for gastrointestinal stromal tumors.
23674192 Ki-67 was associated with common histopathological parameters, but was shown to be an independent prognostic parameter for DFS and OS in breast cancer patients.
23643983 Ki-67 protein may be regulated by specific miRNA-mRNA interactions which may contribute to the proliferation of glioma cells.
23614934 In patients with breast cancer neoplasm grade and expression of BRCA1, Lys27H3, vimentin, and KI67 can be used to predict BRCA1 germline mutations.
23594232 The results predict that an increased level of MIB-1 (Ki-67) expression in tumour tissue, points to a less favourable outcome for ovarian cancer patients.
23579216 Grade according to Ki-67 was a better prognostic marker than mitotic count for metastatic pancreatic and midgut neuroendocrine neoplasms.
23550775 Phosphohistone-H3 and Ki-67 immunostaining in cutaneous pilar leiomyoma and leiomyosarcoma (atypical intradermal smooth muscle neoplasm).
23545927 The assessment of syndecan-1 and Ki-67 expression in skin biopsies is a helpful tool for differentiating keratoacanthoma and squamous cell carcinoma
23526930 In multivariate analysis, Ki67 remained the only significant prognostic factor in the subgroups of ER positive HER2 negative early-stage (pT1-pT2, pN0) breast cancer.
23511287 Ki67 gene up-regulation was noted at the donor site wound healing process.
23509992 Ki-67 overexpression was a positive predictor of survival in colorectal liver metastases.
23382998 distribution pattern of Ki67 may be a new independent prognostic factor for breast cancer
23382631 Ki-67 presents a significant prognostic factor for gastrointestinal stromal tumor recurrence.
23359198 Ki-67 may be a good marker of biological aggressiveness useful in selecting patients for more aggressive treatment in prostate cancer
23343959 Livin expression was positively correlated with the proliferation marker Ki-67, but was negatively correlated with caspase-3 expression in human ampullary carcinoma patients.
23301386 Polyps in postmenopause have a high COX-2 expression that is higher in malignant polyps than in benign polyps; there was no difference in Ki-67 and Bcl-2 expression between malignant polyps and premalignant/malignant polyps.
23286956 KI67 antigen is significantly higher in young breast cancer patients than in older ones
23266046 Data indicate that higher number of intratumoural FOXP3+ Tregs was associated with a more advanced tumour stage and higher Ki67 labelling index.
23244127 High Ki-67 expression is associated with proliferation in salivary gland tumors.
23240716 Assessment of the Ki67 index remains a useful prognostic tool if assessment is performed in the relapse situation.
23235554 Ki67 overexpression is associated with central nervous system metastases in operable breast cancer.
23184081 Disease free survival was significantly different between patients whose Ki-67 was reduced and those not reduced for Luminal B, triple negative and HER2 negative breast cancer.
23139965 The Ki67 marker was more important factor than P53 protein in prognosis of the breast cancer patients in Iran.
23137549 A predictive impact of ki-67 to treatment in non-small cell lung cancer remains unclear. [review]
23135572 In untreated patients, Ki67, TOP2A, and RacGAP1 are significant and independent prognostic markers.
23096218 High Ki67 protein expression was an adverse prognostic factor for death in high-risk early breast cancer patients
23042264 A positive correlation between MT and Ki-67 expression was observed for all the studied cases but was even stronger in the metatypic subtype of basal cell carcinoma.
23040923 A moderate correlation between the stage of endometriosis and the degree of Ki-67 staining was found.
23030583 Decreasing expressions of HIF-1alpha, Bcl-2 and Ki-67 were observed during chemoradiotherapy of recel cancer, whereas GLUT-1 overall was unchanged.
23026928 Digital image analysis and manual counting are the acceptable standards for Ki67 assessment in neuroendocrine tumors of the gastroenteropancreatic system.
23016458 We quantified the spatial distribution of Ki67-expressing cells within the epithelium in a large cohort of 613 lung biopsy sections
23003335 The data show that p16(INK4a) /Ki-67 co-expression allows most HG cancer cells to be detected initially and in the follow-up period
22995634 Tumor sizes and high Ki67 PI in the invasive front appear to be important prognostic tools for head and neck squamous cell carcinoma.
22976139 Ki-67 expression revealed pituitary adenomas with progression had a mean proliferation index of 3.66 +/- 3.00%, which was significantly higher than in tumors without progression of 1.89 +/- 1.25% (mean +/- SD, n = 27) (p < 0.05, Mann-Whitney test)
22939959 Although there is no difference in overall survival between primary breast tumors with less than or at least 10% Ki-67 expression, there is significantly better overall survival when Ki-67 expression in lymph nodes is less than 10%.
22932087 The Ki-67 proliferative index was high in 4 of 15 (27%) carcinomas, 1 of 19 (5%) adenomas, and none of the hyperplasia or normal tissues.
22901702 FDG uptake in malignant melanoma is determined by GLUT-1 and GLUT-3, whereas HK-2 and Ki-67 play no role in FDG uptake of malignant melanoma
22892062 Results suggest that rigorous comparisons of measurement approaches should be applied in a tumour-type and treatment-specific manner to enhance the clinical application of Ki67 assessment.
22890751 High Ki67 expression in the primary tumor is an independent adverse prognostic factor in metastatic breast cancer.
22886115 Over-expression of Ki-67 proliferation protein was found in 62% of colorectal carcinoma cases.
22783570 The combination of Galectin-3 and PTTG is complementary as a diagnostic biomarker for patients with papillary carcinoma.
22778705 The results of this study indicated that the higher MCM-2 expressions in RC than the KCOT might be related to the inflammation and this protein might be more sensitive to inflammation.
22752375 High Ki-67 expression is associated with response to therapy in liver malignancies.
22734595 MIB-1 labeling index predominantly affected the pattern of failure in glioblastoma patients treated with a multimodal approach
22675168 Data show that the high sensitivity of p16/Ki-67 with significantly improved specificity compared with HPV testing makes p16/Ki-67 a viable option for low-grade squamous intraepithelial lesion (LSIL) triage.
22639545 It is thought that Ki-67 and AgNOR might be helpful as a prognostic marker for the recurrences of keratocystic odontogenic tumors.
22631655 upregulated CENP-H and Ki67 levels are significantly associated with short relapse-free survival in hypopharyngeal squamous cell carcinoma (HSSC); these factors may be predictors of a relapsing phenotype in HSSC cases
22590818 Stromal Ki-67 expression was statistically correlated with epithelial ER-beta, epithelial AR, and stromal ER-beta expression.
22575865 These findings do not provide best evidence for the routine use of Ki-67 index to prognosticate overall short-term survival in patients with pulmonary carcinoid tumors.
22554964 Scoring of the percentage of Ki67 expressing cell nuclei is diagnostically useful and reproducible in terms of delineating flat lesions of the bladder mucosa.
22542077 The expression of MIB-1 was statistically elevated in higher-grade osteosarcoma patients 25 years or younger and in tumors located in extremities and metastatic lesions.
22534537 Higher expression of Smac and Ki-67 appear to play a role in the pathogenesis of pancreatic cancer. Combined detection of these proteins may improve the prognostic evaluation of this disease.
22531522 Ki-67 staining, a reflection of tumor-proliferation activity, was significantly related to the FDG uptake value in lymphoma lesions.
22520514 lower levels of Ki-67 and PCNA expression were measured in cellular leiomyomas than in leiomyosarcomas
22499302 Osteopontin expression seems to be related to Ki-67 (proliferation index) and CD34 expression (angiogenesis marker) confirming its role in the pathogenesis of psoriasis.
22492957 High MIB1 proliferation index trended toward worse response to adjuvant radiotherapy in gliomas.
22452996 HIF-2a was correlated with ABCG2 expression, histology-grade and Ki67 expression in breast invasive ductal carcinoma
22419713 Determination of the expression of Ki-67 in an attempt to establish correlations and/or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas.
22395508 analysis of P53, Bcl-2 and Ki67 immunoexpression in follicular solid ameloblastomas
22395505 analysis of P53, p16 and Ki67 immunoexpression in oral squamous carcinomas
22372356 Ki-67 expression was higher in patients with high-grade endometrioid carcinomas.
22361634 Women with a HER2/neu/neu+/Ki67+ ductal carcinoma in situ (DCIS) have a higher risk of developing DCIS local recurrence after breast-conserving surgery.
22335907 Low MGMT expression and high Ki-67 expression were more frequent in oligodendrogliomas than in astrocytomas and mixed tumors.
22335622 In anaplastic oligodendroglial tumours the Ki67 index has a strong prognostic impact on univariable analysis.
22309998 Increased Ki-67 and bcl-2 expression plus density of new vessels are of prognostic value for the disease outcome in medulloblastoma patients.
22300665 There was a significant relation between CD10 expression as well as Ki67 labelling index and recurrence of ameloblastoma
22277792 Report apoptosis along with BCL-2 and Ki-67 expression in individuals with intestinal metaplasia, chronic active gastritis, and normal gastric mucosa.
22248824 Ki-67 overexpression (Ki-67 >/= 10%) was identified as an independent prognostic factor for distant-metastatic-free survival (DFS) and overall survival (OS) by univariate and multivariate analysis.
22205326 Ki67 was a significant predictor of disease progression and should be considered in determining appropriate treatments and planning follow-up for patients with neuroendocrine tumors.
22199292 Ki-67, but not proliferating cell nuclear antigen, has a role in poor disease free survival in patients with adenocarcinoma of the lung
22197541 Ki-67 and p53 staining may be helpful adjuncts in the differential diagnosis of Necrotizing sialometaplasia from squamous cell carcinoma in appropriate clinical setting.
22172851 Ki-67 staining percentage may represent a marker to select hepatocellular carcinoma patients for liver transplantation and to follow posttransplant recurrence.
22169637 The high-grade serous carcinomas had a significantly higher expression level of p53 and Ki-67, while low-grade carcinomas had a significantly higher expression level of Pax2.
22147251 Ki-67 antigen,which reflects cell proliferation,was overexpressed in the majority of Barrett's epithelium samples.The finding of strong Ki-67 antigen expression in long segments of metaplastic epithelium may be related to increased malignant potential.
22126395 The combination of E-cadherin and Ki67 status might be a useful prognostic marker indicating the need for adjuvant chemotherapy in Stage II TNBC patients.
22125028 it was demonstrated that the region from -223 to +12 nt could drive the transcription of the Ki-67 gene, and the Sp1 binding site is essential to transcriptional regulation of the Ki-67 gene.
22043024 High-grade tumors overall showed significantly higher claudin-4 and Ki-67 and significantly lower claudin-7 expression when compared with low-grade ones.
22040408 Low expression of Ki-67 was correlated with multiple lesions and high expression of KI-67 may be related with tumor across the midline in patients with glioblastoma multiforme.
22040407 Proliferation marker Ki-67 is an independent prognostic indicator in Chinese GBM patients.
22024151 This study suggests that Ki67 is an independent predictor of poor prognosis in patients with gastrointestinal stromal tumors.
21979598 The expressions of p16, Ki-67, and L1 proteins and human papillomavirus DNA were investigated as potential molecular markers for the diagnosis and transforming potential of low cervical intraepithelial neoplasia
21965052 High Ki-67 expression correlates with morphologic features of aggressiveness and the expression pattern of Ki-67 correspond to the expected cyclic/atrophic pattern in normal endometrium.
21937080 The Ki-67 index predicts progression-free survival of patients with ileal well-differentiated neuroendocrine tumors.
21935871 Parathyroid adenomas come into existence as a result of neoplastic proliferation of PCNA/Ki-67 positive chief cells, especially vacuolated chief cells.
21881319 Ki-67 labeling index after video-assisted thoracoscopic surgery segmentectomy was a prognostic factor of disease-free survival in stage I non-small cell lung cancer.
21840910 analysis of Aurora A and B kinases, Ki-67 and the estrogen and progesterone receptors from an endometriosis tissue microarray model
21819622 Data indicate that assessment of Ki67 in 200 tumor cells showed an absolute average proliferation difference of 3.9% between core biopsies and surgical samples with the core biopsies being the more proliferative sample type.
21809665 In grade 3 samples of CIN (Cervixal Intreapithelial Neoplasia), expression of Ki-67, separately or combined with thymidine phosphorylase, seemed to be related to progression to invasive cancer. Ki-67 levels were shown to correlate directly with CIN grade.
21792693 Data suggest that there is no correlation between Ki-67 LI or cytokeratin distribution pattern and MGMT immunoreactivity in GH-secreting pituitary adenomas. These data may have implications in drug resistance regarding treatment with temozolomide.
21778791 immunohistochemical expressions of cyclin D1, p16(INK4a) and Ki-67 were analyzed in a total of 127 cases showing multinucleated giant cells
21753697 MIB-1 and p53 immunohistochemistry do not correlate with aggressive features in the most common type of giant pituitary adenoma.
21738398 The expression levels of PCNA, Ki-67, Bcl-2 and mP53 are significantly increased in the pterygium samples as compared to the normal conjunctiva samples.
21694464 Studies indicate that 48 biomarkers have been identified for ccRCC patients, only CD44, CA9, p53, Ki67 and PCNA have shown prognostic value, and IMP-3 and VEGF-R2 are predictors of survival of pRCC patients.
21680106 The differential expression of DUSP6 correlated with Ki-67 index, suggesting that DUSP6 plays an important role in cancer resistance in different subtypes of non-small cell lung carcinoma.
21677540 p53 overexpression and increased Ki-67 proliferation index were more evident in gastric pit dysplasia compared with adjacent gastric mucosa.
21664839 Results indicate that carbonic anhydrase IX (CA IX) expression was not associated with patient age, T stage, grade, lymphovascular invasion, and Ki-67 expression, but was associated with p53 expression.
21655657 The study included a total of 28 cases of urothelial carcinomas, which were analyzed histopathologically and immunohistochemically using anti-human p16, c-erbB2 and Ki67 antibodies.
21655654 The prognostic value of the correlations between the expression of estrogen and progesterone receptors, Ki67 expression and the histological stage, tumor stage, the degree of myometrial and vascular invasion, was investigated.
21655651 The aim of this work is to study the distribution of CD105 positive vessels and the proliferation rate of endothelial cells from liver metastasis of colon carcinoma based on double immunostaining CD105/Ki67.
21652010 Multiple sclerosis patients treated with interferon (IFN)-beta alone or in combination with low-dose prednisolone display increased proportion of all natural killer (NK) cell subsets in the active phase of the cell cycle (Ki-67+).
21642658 For women </= 35 years, TP53 mutations, Ki67 and HER2 expressions are strong prognostic factors.
21629784 Findings define a MKI67, TOP2A, and E2F1 tri-marker proliferation index with possible utility for improved prognostication and treatment stratification in prostate cancer.
21611785 p53 inhibited Ki-67 promoter activity via p53- and Sp1-dependent pathways
21610457 Both semiscale and fullscale quantitative analyses of Ki67/MART1 stains are valuable diagnostic tools to distinguish melanomas and nevi with a large degree of certainty.
21572399 we investigated atypical tubal metaplasia in regard to its immunoexpression of p53, Ki-67, and human telomerase reverse transcriptase (TERT), and its long-term clinical outcome
21524841 findings indicate that miR-519d targets the MKi67 transcript and suppresses HCC cell growth, suggesting that miR-519d has a tumor suppressive role in human HCC pathogenesis
21478101 lack of Ki-67 proteins expression which may explain commonly known low mitotic activity of desmoid tumour cells
21435003 Nondysplastic leukoplakias without dual p53p16INK4a and triple p53p16INK4aKi-67 aberration seem to be harmless. Nondysplastic leukoplakias with these aberrations are at risk of progression, with very promising positive predictive value.
21424069 The purpose was to correlate markers expression of apoptosis (p53 and bcl-2) and cell proliferation (Ki-67 and PCNA) with histological indicators of tumor severity.
21422198 combined evaluation of RET and Ki-67 could act as an adjuvant prognostic marker useful for ameliorating the initial risk stratification of patients with medullary thyroid carcinoma
21371741 reduced immunostaining of PCNA and Ki67 and increased immunostaining of p27 and p57 in the dexamethasone-induced intrauterine growth restriction placental development compared to control placental development
21366896 Triple negative breast cancer with high Ki-67 was associated with a more aggressive clinical feature despite a higher pathologic complete response rate.
21354936 In hormone-independent breast cancer cases negative for CerbB-2, Ki-67 and P53 expressions were significantly higher than that in hormone-dependent CerbB-2-negative cases.
21334717 A prognostic index in skin melanoma through the combination of matrix metalloproteinase-2, Ki67, and p53.
21325804 The aim of this study was to investigate the correlation between the expression of EZH 2 with p53 and Ki-67 expression and other clinicopathological parameters in primary breast carcinomas.
21302028 Data show that colocalization of CAIX, a membrane-bound hypoxic marker and Ki-67, a nuclear proliferation marker were well analyzed with parametric mapping of immunohistochemistry.
21210727 FOXP1 expression negatively correlated with Ki67 expression in clear cell renal cell carcinomas (p = .036).
21111561 Ki67 after NAC, but not before NAC, is prognostic in breast cancer patients
21097442 study demonstrated a positive correlation between expressions of Ki-67 and MCM-2 in ductal breast cancers; most intense expression of these two markers was demonstrated in G3 grade cancers
21080107 Negative EGFR, high Ki-67 proliferation index, and positive nm23-H1 were found to be significantly predictive of a pathological complete response in breast cancer patients.
21062978 Data show that the prognostic abilities of TOP2A and MIB-1 were significantly better in ERG(-) patients.
21058037 Overexpression of KI-67 is associated with neuroendocrine carcinomas.
21045152 Data show that the antibody TuBB-9 targeting a physiologically active form of pKi-67 but not with MIB-1, directed to a different epitope.
20871219 We conclude that Ki-67 labeling detects anal HPV-related changes with a high degree of sensitivity and specificity.
20868604 There was no correlation of Ki-67 expression and tumor stage or grade in head and neck squamous cell carcinoma.
20848772 The positive intensity of Ki67 protein expression in primary ovarian cancers was significantly higher than in metastatic ovarian cancers.
20840814 The high expression of CAIX in non-small cell lung cancer tissues is correlated with VEGF level but not with Ki67 level.
20819770 MIB-1 showed a weak expression in the basement membrane of the mucosal epithelium and a total absence in the lamina propria deep layer
20809021 Most cases that were p53 positive had an increased proliferation activity, as determined with Ki67.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20800066 intracellular Ki67 expression provides a specific, quantitative and reproducible measure of antigen-specific T cell proliferation in vitro.
20694513 MCM-2 expression did not show significant associations with any clinicopathological parameters, while Ki-67 expression was merely significantly associated with tumor size. Neither MCM-2 nor Ki-67 expression sad significant prognostic value.
20686376 High KI-67 is associated with endometrial cancer.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20627009 Patients with a higher expression of Ki67 has a better tumor response to the chemotherapy.
20598358 Ki-67, bcl-2 and caspase-3 positive cells changed in a temporally and spatially restricted manner coincident with upper jaw differentiation
20557372 Endometrial adenocarcinomas show micro-anatomical variations in Ki67 expression and this is often inversely correlated with CK7 immunoreactivity.
20487522 CD133 expression positively correlates with that of Ki-67 in gastric adenocarcinoma.
20483025 A review of literature is carried out to correlate the role of Ki-67 labeling index and its correlation with clinical findings, tumor size, invasiveness, recurrence, adenoma subtype, adenoma doubling time, and pituitary carcinomas is addressed.
20450760 High levels of HER2 and Ki-67 or TK1 expression correlate with the increase of tumor grades and tumor recurrence in meningiomas.
20442586 High MIB1 is associated with high-grade ovarian serous carcinomas.
20414055 overexpression in esophageal mucosa correlates with the severity of esophagitis
20398247 Ki-67 was a stronger and more robust prognostic indicator than mitotic count in this series of nodular melanoma.
20381119 expression of CD147 was positively correlated with matrix metalloproteinase-2, Ki-67 labeling index, or both in invasive pituitary adenomas (P< .01 and P< .01, respectively).
20369584 Prognostic value of of the expression Ki-67, CD31, and VEGF in somatotropinomas
20369488 The expressions of P53, P21 and Ki67 proteins are closely related with the pathogenesis and progression of nasal NK/T-cell lymphoma.
20353905 High MIB-1 expression is associated with gallbladder carcinoma.
20338617 Increased expression of Ki-67 was associated with the presence of lymph node metastasis, advanced stages of disease, tumors occurring in the floor of mouth, and moderately/well-differentiated oral squamous cell carcinoma.
20223108 MLH1, MSH2 and MSH6 expression in initial glioblastoma lesions is significantly associated with the Ki67 antigen proliferation index.
20198771 There is a significant statistical difference between immunohistochemical expression of p16(INK4a) and Ki-67 in HPV-associated dysplastic and non-dysplastic vulvar lesions.
20189840 MIB1 overexpression is associated with urothelial carcinomas of the upper urinary tract.
20181625 There is no statistically significant association between the expression of Ki-67 and overall survival or relapse of patients with laryngeal cancer. Nuclear MSH2 staining was statistically significantly correlated to Ki-67 expression.
20105109 no significant correlation with disease-free survival in nasopharyngeal carcinoma
20103726 The clinical trial of Kim et al. shows an effect of the cyclooxygenase-2-selective inhibitor celecoxib at a high dose on Ki-67 expression in the normal bronchial epithelia of current and former smokers.
20103652 Data show that SOX9 expression was associated with increasing Gleason grades and higher Ki67 staining in prostate cancer samples.
20099418 The Ki-67 Labeling Index in the malignant GIST group was higher than that in the benign group, in the p53-positive cases was higher than that in the p53-negative cases, in the C-kit-positive group was higher than that in the C-kit-negative group.
20095356 CyclinB1, FHIT and Ki-67 may play significant roles in the occurrence and evolution of gastric carcinoma.
20082479 The expression of p53, c-erbB-2 and Ki67 proteins in 20 simple intestinal metaplasia (SIM), 27 atypical intestinal metaplasia (AIM), and 37 gastric carcinomas showed significant differences between SIM and gastric carcinomas.
20038236 Data show that a positive correlation was observed between the SUVmax on FDG-PET at the biopsy site and the Ki-67 proliferation index (MIB-1 labeling index).
20030866 Studies indicate that Ki67 at baseline is a highly prognostic factor in breast cancer.
20030864 Studies indicate that Ki67 at baseline is a highly prognostic factor in breast cancer.
20010526 patients with Gleason scale > 8 prostate cancer were characterized by the highest nuclear expression of p53, p16INK4a and Ki-67, and also by overexpression of cytoplasmic Bcl-2.
20001343 Toker cells and mammary Paget cells differ substantially in their expression of ER, c-erbB-2 and Ki-67.
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19952937 An immunochemical study of the expressions of Ki-67, estrogen receptor, progesterone receptor, and p53 in 9 cases of symplastic uterine leiomyomas was performed.
19946260 This study evaluates the association of Forkhead-box protein A1 (FOXA1) and GATA-binding protein 3 (GATA3) expressions with Oncotype DX recurrences scores in 77 cases of patients with ER-positive node-negative breast carcinomas
19935641 Ki67 is a prognostic factor in node-negative breast cancer
19901884 Report correlation of the standardized uptake value in FDG-PET with the expression level of Ki-67 antigen in resected non-small cell lung cancers.
19854077 Data show that the CIS surrounding morphologically normal urothelium with a high frequency of abnormal DNA content, clear aneuploid cells, p53 mutated protein expression, and a proliferative status underlying a field carcinogenesis.
19832838 Genes previously shown to be of relevance in high-grade gliomas include MIB-1/Ki-67, tp53, and O6-methylguanine-DNA methyltransferase(MGMT); however, they are not significant biomarkers of outcome in pilocytic astrocytomas.
19818763 MCM3 may be a more reliable proliferation marker than Ki-67 in accessing the growth of tumor and evaluating tumor aggressiveness of papillary thyroid carcinoma.
19788614 Endothelial proliferation assessed on Ki-67 combined with the lack of CD105 expression is often associated with invasive cervical carcinoma.
19777788 the quantitative and qualitative (pattern of distribution) evaluation of the expressions of Ki67, P27 and P53 may be helpful in differentiating malignant and premalignant epidermal lesions, particularly in unsatisfactory or fragmented specimens
19774459 Ki67 appears to be a time-varying biomarker of risk of breast cancer in women with atypical hyperplasia
19773751 increased EZH2 protein expression and Ki-67 expression in >40% of the tumour cells are both associated with an improved relapse-free survival in colon cancer stages II and III, but not so in rectal cancer.
19723039 High mitotic index (MI) and high MIB-1 expression were found.
19690767 The main objectives were to assess tumor proliferation and invasiveness biomarkers (Ki-67, E-cadherin) and to identify potential correlation between biomarkers and classic prognostic factors in cervical cancer.
19690760 P63, followed by Ki-67, showed better correlation with cancer progression than p53.
19687314 Positive expression of p16, Ki-67, and ProEx C and negative expression of p53 seem to be related to HPV-16 infection
19602458 An immunohistochemical and molecular study of the BCL2, MKI67, and CCND1 genes in Synovial sarcoma (SS) was performed. The high level of BCL2 mRNA correlated with a high level of CCND1 mRNA, but not with MKI67 mRNA level.
19593135 Studies indicate that estrogen receptor-positive tumors with increased proliferation, evaluated by Ki-67, may be selectively responsive to aromatase inhibitor therapy.
19585492 Both Ki-67 and c-kit immunoreactivities were explored and compared with both normal breast tissues and subsequently documented cancers.
19584075 Observational study of gene-disease association. (HuGE Navigator)
19559929 The results of this study showed that MIB-1 LI is a rapid and cost-effective modality for predicting tumor grade in oligodendrogliomas.
19519606 The staining pattern for p16 in desmoplastic melanomas and Spitz nevi in conjunction with the histopathologic features, S100 staining, Ki67 proliferation index and clinical scenario may aid in the difficult differential diagnosis
19470936 Combined MDM2 and Ki-67 expression levels could be considered for risk stratification of patients with prostate cancer in clinical trials.
19462897 The expression of Ki67 in squamous carcinoma of cervix was not correlated with the major clinic pathological parameters, and there was no obvious relationship between the expression of RhoC gene and Ki67 antigen.
19452712 The expressions of p53, p21 and Ki67 proteins are closely related with the pathogenesis and progression of nasal NK/T-cell lymphoma.
19446313 Immunodetection of HER2/neu receptor correlated positively with both ERalpha and PR immunolabelling. The Ki-67 proliferation index correlated only with ERalpha immunopositivity.
19436038 Expression of ER, progesterone receptor, and HER2 proteins and the Ki67 index appear to distinguish luminal A from luminal B breast cancer subtypes
19351506 Data show that the over-expression of hTERT, c-myc and Ki-67 may play a vital role in the progress of hepatocellular carcinoma developing.
19351365 The present results suggest that the decrease in syndecan-1 expression and increase in the Ki-67 index observed in ameloblastic carcinomas is in accordance with its higher aggressiveness as compared to the rare desmoplastic and peripheral ameloblastomas.
19350669 Results indicated that Ki-67 evaluation in routine EUS-FNA cytology specimens can be used as a potential prognostic marker in pancreatic NETs.
19342238 For routine clinical purposes, grading appears to add only limited information about the prognosis in comparison with Ki-67 expression
19340613 Concurrent expression of Ki67 and CD34 may be an important characteristic and involved in the progression of colorectal cancer.
19291919 Ki67 immunoexpression was significantly correlated with raised transaminases in hepatocellular carcinoma
19220627 All multicentric and nodular basal cell carcinomas displayed a prominent loss of Srcasm staining in association with a marked increase in Ki-67 staining.
19207951 Membranous/cytoplasmic Ki67 identifies a group of breast carcinomas that may be important to consider separately in prognostic and predictive studies
19195690 Immunohistochemistry detected inhibin-alpha, -betaA and -betaB, Ki67, p53 and glycodelin A in invasive trophoblastic mole.
19173807 Standard uptake value of 18F-FDG PET-CT is linearly correlated with the expression of GLUT1, but not with the expression of Ki67.
19162366 high expression is associated with post-operative recurrence of lung adenocarcinomas
19160064 Data show that Cav-1 expression in tumor tissues was correlated with both the Ki-67 and p53 expression.
19157151 The expression of EGFR, Ki67, p16 in middle ear cholesteatoma was significantly higher compared with controls.
19152245 Clonal status was associated with the expression rate of Ki-67 to a certain extent, which may be useful in assessing susceptibility to gastric carcinoma
19144445 MCM7 is a more reliable marker than MCM2 or Ki-67 in lung adenocarcinomas
19138978 Trends suggested down-modulation of cyclooxygenase-2 and Ki-67 in some tissues, increased pAKT-Ser473 expression, and an inverse relationship between PGE(2) and BCL2 expression.
19130399 Analysis of Ki-67 expression in aggressive fibromatosis (desmoid tumor) is reported.
19102938 Tumors with lower Ki67 expression were more sensitive to neoadjuvant therapy than that with higher expression of Ki67.
19093259 Correlation between poor survival and altered expression rates of Ki67 in salivary malignancies indicate a biological role in salivary cancer pathogenesis.
19082441 Clinical outcome of bladder urothelial tumours showed a significant correlation with MIB1 LI and molecular grade.
19080002 Overexpression of Bmi-1 and Ki67 protein are significantly correlated with tumorigenesis, metastasis and prognosis of colorectal carcinoma.
19077408 peripheral blood lymphocyte CD25 and Ki67 have roles in renal cell carcinoma
19050681 Expression of p53, BCL-2 and Ki-67 was upregulated in clinically localized prostate cancer compared with benign prostate tissue, with no alteration in E-cadherin expression.
19032382 Human eccrine sweat glands express CK7, CK8, CK14, CK18, CK19, CEA, EMA, Ki67, p63, EGF and EGFR. In skin, CEA can be used as a specific immunological marker of sweat glands.
19023099 Observational study of gene-disease association. (HuGE Navigator)
19019173 significant interrelationships of the investigated molecular alterations and clinicopathological characteristics in diffuse gliomas, which support a promising role of molecular markers (MGMT, p53, Ki-67)in the diagnostic assessment of these neoplasms
18982746 Its expression is prognostic parameter in breast carcinomas.
18949744 analysis of the expression of fatty acid synthase, Ki-67 and p53 in squamous cell carcinomas of the larynx
18822690 Overexpression of Ki67 was negatively correlated with cell differentiation in gastric carcinoma.
18798277 In this immunohistochemical study, 80% of all vulvar intra-epithelial neoplasia were positive of MIB1 protein.
18798062 Ki-67 plays a role in breast carcinoma cell proliferation & invasion. Expression of Ki-67 is essential for cell growth & tumorigenicity.
18778369 proliferative marker Ki-67 was analyzed in 11 nasal NK/T-cell lymphoma cases by immunohistochemical methods
18766962 low Ki-67 expression also remained as an adverse prognostic factor in DLBCL, independent of non-GCB phenotype and bcl-2 expression
18766188 Ki-67 expression level is a potentially useful clinical marker for predicting recurrence in surgically treated stage I oral tongue squamous cell carcinoma
18762814 Ki-67 LI merits further study as a possible biomarker of early prostate cancer behaviour.
18727426 Significance of the expression of nucleolar argyrophilic proteins and antigen Ki-67 in the evaluation of cell proliferative activity and in the prediction of minimal (T1) lung cancer
18705408 Ki-67 and bcl-2 expression was correlated with tumor grade, and the higher the tumor grade, the higher the Ki-67 and bcl-2 expression.
18690204 Inhibition of renal cancer cell growth in vitro and in vivo with oncolytic adenovirus armed short hairpin RNA targeting Ki-67 encoding mRNA
18674924 Ki-67 expression is likely to be associated with tumour recurrence and poor prognosis in jaw bone ES in adult patients.
18665038 The pattern and extent of Ki-67 are useful parameters for identifying dysplasia in Barrett esophagus.
18592370 Post-chemotherapy Ki67 is a strong predictor of outcome for breast cancer patients not achieving a pathological complete response
18572327 Report relationship of Ki67, TP53, MDM-2 and BCL-2 expressions with WHO 1973 and WHO/ISUP grades, tumor category and overall patient survival in urothelial tumors of the bladder.
18561741 Expression of Ki-67 in cervical intraepithelial neoplasia and invasive squamous cell carcinoma of the uterine cervix
18546942 Ki67 expression was higher in planoepithelial metaplasia and eosinophilic infiltrations.
18516322 The role of p53, followed by Ki-67, as predictive factors.
18510217 Ki-67 and PCNA are related to proliferation activities of tumor cells in acoustic neuromas.
18496701 DPPIV-expression and enzyme activity, Ki-67 antigen and K16 are significantly upregulated in the centre and inner margin of the psoriatic lesion compared to clinically uninvolved skin and the healthy volunteers skin.
18439942 Ki-67 labeling index was an independent predictor of progression (multivariate analysis, P < .011). p53 was positive in 12.5% of cases with surgical progression and in 9.6% of cases without progression, but the difference was not significant.
18374497 Conclude that the Ki-67 and p53 labeling indices are useful additional tools in discriminating atypical from benign or anaplastic meningiomas.
18331287 Non-smoking and non-drinking patients with squamous cell carcinoma have the same risk for developing multiple tumors as their smoking and drinking counterparts without an increased expression of Ki-67.
18312749 The combination of Ki-67 and PCNA, specific proliferative markers of PCa, may improve the accuracy of early diagnosis of prostatic cancer.
18301453 Only FIGO stage, cyclin D1, p27 (Kip1) and Ki-67 are independent prognostic factors that might help in predicting outcome of cervical cancer patients.
18256893 Ki-67- and p53-immunostained cells were mainly located in the suprabasal layers. p63-positive cells were found throughout the lining cystic epithelium.
18234277 In ER-alpha-negative tumors, we detected a correlation between ER-beta protein expression and high levels of Ki-67.
18165175 Aim of the studies included detection and subcellular localization of three HCV proteins (NS3, NS5A and C) in liver biopsies from adults (n=19) with chronic, long lasting hepatitis C as related to hepatocyte proliferative activity.
18095132 expression of p53 and Ki-67 antigen is helpful to predict tumor recurrence and prognosis in skull base chordomas
18077791 Ki-67 index remains an important prognostic marker in the era of anti-CD20 therapy in advanced mantle cell lymphoma.
18038314 No significant association was observed between FHIT and Ki-67 expression in malignant pleural mesothelioma
18019405 high cyclin expression may contribute to deregulation of the cell cycle in bone and soft tissue tumors
18018472 MIB-1(Ki-67) positive tumor cells were maximally aggregated at the periphery of an excised specimen and can provide better information about the disease biological nature in benign meningiomas
18005189 in colorectal cancer patients c-reactive protein levels and Ki67 (proliferation-related Ki-67 antigen) expression were associated with poorer cancer-specific survival; Ki67 labelling index and C-reactive protein were correlated.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17972530 These results suggest that papillary thyroid carcinomas with BRAF (V600E) mutation are more aggressive than those with wildtype BRAF.
17923265 Expression of CCND1 is correlated with Ki-67 expression.
17885492 Ki-67 represents an independent prognostic predictor in stage III ovarian cancer.
17848143 p53 and Ki-67, but not bcl-2, cyclin D1 or HER-2 may have roles in the process of tumor genesis in non-small cell lung carcinoma
17805549 Ki-67 levels were not helpful in identifying patients who would benefit from neoadjuvant treatment of rectal cancer.
17713095 p53 expression may have a role in the carcinogenesis of squamous cell cervical carcinoma whereas Bcl-2 expression has no role. Ki-67 expression can not be used in determining the aggressiveness of CIN lesions
17695500 Ki-67 antibody and cyclin D1 overexpression seem to parallel each other, supporting the concept that cyclin D1 serves as a cell cycle activator in squamous cell carcinoma of the penis.
17693651 Ki-67 expression is predictive of prognosis, and our prognostic model may become a useful tool for predicting prognosis in patients with stage I/II extranodal NK/T-cell lymphoma, nasal type
17674766 Expression rates of EGFR and Ki-67 in squamous cell carcinoma of nasal cavity and paranasal sinuses were significantly higher than that in nasal inverted papilloma and nasal polyps.
17647192 findings suggest Ki67 expression as a prognostic marker for lymph node metastasis in penile squamous carcinoma
17594714 Ki-67 and coagulative tumor necrosis both should be evaluated when generating outcome predictions for patients with clear cell renal cell carcinoma.
17593084 The Ki67+ proliferation index was inversely correlated with desmoplakin and plakophilin-1 during cervical squamous cell carcinogenesis
17545048 p16, p53 and Ki-67 expressions were all negative in normal cervical epitheliums, but all positive in cervical intraepithelial neoplasia.
17531085 crucial role of pKi-67 in RNA polymerase I-dependent nucleolar rRNA synthesis
17525640 Expression of MKI67 as a proliferation marker was studied, using MIB-1 antibody.
17525638 When MKI67 immunohistochemistry is used for diagnostic purposes in a suspected hyaline trabecular tumor of the thyroid, only MIB-1 clone at room temperature should be used.
17525627 There are significant differences between Ki-67 indices and CCND1 expression among melanocytic lesions.
17490723 The present study showed elevated expression of topo-I, Ki-67, and mutant p53 in patients with uterine carcinosarcoma suggesting sensitivity to topo-I-targeted drug treatment.
17377809 Ki-67 index and PIK3CA amplification were strong predictors for an early tumor-associated death in ovarian cancer patients.
17310847 No siatistically significant value in assocation with survival or event-free survival in head and neck squamous cell carcinoma.
17296585 MUM1 expression dichotomises follicular lymphoma (FL) into low-grade FL of CD10+/Bcl-6+/MUM1-/Ki-67low phenotype, and high-grade FL of CD10+/- /Bcl-6+/weak/MUM1+/ Ki-67high phenotype
17285761 Analysis of p27 and Ki-67 expression levels might indicate that low proliferating activity of desmoid fibroblasts is connected with another mechanism than the one, in which p27 takes part.
17234468 The basal-like subtype was associated with elevated Ki-67 index.
17227124 This study shows that histologic features are reliable in identifying granular cell tumors that have a higher proliferative potential as shown by higher immunoreactivity for Ki-67 and phosphorylated histone H3 (PHH3).
17225522 The expression of STAT3 was positively related to that of Survivin and Ki67 in in nasal NK/T cell lymphoma.
17188136 p53 and Ki-67 were expressed with increasing frequency, and bcl-2, p21, and mdm-2 with decreasing frequency in thyroid carcinoma progression. p27 and cyclin D1 were expressed in <15% of cases, with a trend toward decreasing expression.
17143016 In an analysis of breast cancer-specific survival up to 5 years, high Ki-67, high p53, and negative ER as well as aneuploidy of the tumour were significant prognostic factors.
17065089 analysis of Ki67 and thymidylate synthase expression in primary tumour compared with metastatic nodes in breast cancer patients
16984615 Based on these results it is suggested that Ki-67 is a reliable microscopic marker to predict metastatic potential of rectal carcinoids.
16948516 Height of Ki-67 staining within the epithelium increased significantly between mild and moderate and between mild and severe dysplasia.
16882345 Ki-67 did not display apparent prognostic value in NSCLC in the study sample
16804724 In univariate analyses, low Ki-67 proliferation index (P = 0.045) and negative p21 immunoreactivity (P = 0.04) were associated to patient's overall survival.
16739374 Overexpression of Ki67 and VEGF were related to poor prognosis of squamous cell carcinoma of the larynx.
16723309 changes in COX-2 and Ki-67 expression peaked during the proliferative phase and fell during the late luteal phase in endometrial polyps and disease-free endometria
16681683 Ki67 was an independent prognosticator if nodal status, tumour size, age and histological grade were included in the analysis but not if analysed with standardized mitotic index.
16629645 The combination of MCM2, geminin and Ki67 could represent a valuable tool in the understanding of hepatocellular carcinoma progression in cirrhosis.
16623776 Ki67 stain alone is a powerful tool for distinguishing benign from malignant proliferations within the selected groups.
16609045 The Ki-67 Antigen expression was associated with the highest levels of proliferation, suggesting a synergistic effect.
16574316 Ki-67/podoplanin-immunoreactivity was useful to identify proliferating lymphatic vessels.
16573167 Expression of iNOS and Ki-67 protein in hemangioma is significantly higher than that in vascular malformation.
16533178 Increased expression of Ki-67 protein suggests an increased cellular proliferation which is involved in the process of occurrence and progression of epithelial dysplasia in the flat mucosa of colon.
16479062 The expression rate of Ki-67 was relatively high in small cell lung cancer without any prognostic significance.
16385451 Observational study of gene-disease association. (HuGE Navigator)
16351648 To investigate the prognostic and predictive relevance of p53 protein, Ki-67 antigen, MMP-2 and MMP-9 in patients with transitional cell carcinoma (TCC) of the upper urinary tract
16295759 Ki 67 usefulness in studying cellular proliferation, and underline that chronic lymphocytic leukemia (CLL) with polymorphic cytology are more proliferate than typical CLL.
16260903 Cellular biotinylated marker of proliferation Ki-67 (MKI67) protein is incorporated into HIV-1 Gag virus-like particles
16255765 liver expression in HBV and HCV cirrhosis and hepatocellular carcinoma is associated with dysplastic cell changes and tumour grade
16206250 ChIP assays provided evidence for a physical association of pKi-67 with chromatin of the promoter and transcribed region of the rRNA gene cluster. These data strongly suggest a role for pKi-67 in the early steps of rRNA synthesis.
16171567 ability of the gef gene to down regulate Ki-67 expression and induce apoptosis in a breast cancer cell line
16097446 p27(kip1) and Ki-67 have roles in post-surgical disease progression of prostate cancer
16045773 Aberrant proliferative patterns with Ki67 staining are not useful in differentiating reactive epithelia from low-grade dysplasia, but may prove useful in the diagnosis of high-grade dysplasia.
15964376 Proliferative activity of 13 biopsy specimens of Kaposi sarcoma was assessed immunohistochemically using the monoclonal antibody to KI-67.
15953875 Study suggests that the clinical characteristics such as visual field defect and recurrence are correlated with the high Ki-67 labeling index.
15931389 Altered expression is associated with therapy failure and death in patients with multiple types of cancer.
15871722 Ki-67 by itself is a less reliable marker of dysplasia.
15809747 a useful msarkser in patients with lung adenocarcinoma.
15679862 Ki-67 and hTERT have roles in meningioma cell proliferation, but only hTERT has a role in disease recurrence
15638382 Evaluation of expression of PCNA and Ki-67 may provide an additional information about the progression of uveal melanoma.
15638377 Expression of Ki-67, PCNA proteins were closely connected with the high grade of stomach tumour malignancy.
15638357 Expression correlates with intensity of apoptosis in colorectal adenocarcinoma.
15591788 ER alpha and Ki67 might be involved in distinct pathological and molecular features during breast cancer development
15545971 Ki-67 is a factor of poor prognosis for survival in NSCLC.
15452376 Ki-67 LI (labeling index) is a useful prognosticator for PENs (pancreatic endocrine neoplasms).
15217948 Ki-67 may have a role in distant metastasis of radiotherapy-treated prostate neoplasms
15214825 study expands the immunophenotype of granular cell tumor (S100, CD68, protein gene product 9.5, and inhibin-alpha) regardless of location and supports a neural origin
15104289 Mutations in the cDNA of the proliferation marker Ki-67 protein is associated with cervix, colonic and lung neoplasms
14707453 The expression of Ki67 and p53 in various forms of leukoplakia point to the increasing instability of the genome in parallel with the severity of leukoplakia.
14674120 compared the expression of Ki-67 between primary breast tumors and metastasis to regional lymph nodes; estimated the relationships between Ki-67 and the anatomoclinical features of the breast cancer
14659764 nmr analysis of the solution structure of the FHA domain of human Ki67 and mapping of the binding surface for NIFK binding
14627346 Detected in nuclei of neoplastic cells and in nuclei of epithelial cells in adjacent colonic mucosa.
14582704 distribution of staining pattern for Ki-67 paralleled the staining pattern of 34-betaE12
12716386 a biological marker in Langerhans cell histiocytosis
12649825 Ki-67 antigen reactivity was significantly higher in the patient with laryngeal carcinoma remission, compared with the control group.
12647790 Ki-67 proved to be a better prognostic marker, as compared to metallothionein, in large intestine adenocarcinomas
12607601 increased p53 and Ki-67 expression in varying grades of urothelial dysplasia of bladder
12532420 No relationship was observed between Ki-67 staining & the E-cadherin mutation status. The presence of E-cadherin mutations does not correlate with Ki-67 staining.
12485163 Data suggest that marsupial chmadrin and human Ki-67 induce chromatin compaction across species, possibly via the interaction of its LR domain with heterochromatin protein 1.
12479099 Increase of CD44s, MMP-9, and Ki-67 were involved in the growth and local invasion of osteosarcoma.
12434121 p53 and Ki-67 expression in epithelial gastric dysplasia and in gastric cancer.
12432453 This marker is masked to MIB-1 staining after expression of its tandem repeats.
12125971 presence in CNS tumors correlates with histological type and grade
12051866 The combined evaluation of p27Kip1 and Ki-67 expression provides independent information on overall survival of ovarian carcinoma patients.
11925591 Results indicate that loss of RAR-beta expression and accumulation of p 53 and Ki67 proteins may serve as biomarkers for early identification of esophageal cancer in the high-risk populations.
11857304 overexpression may be marker of radioresistance in head and neck cancer
11839580 patients that progressed to breast cancer showed significantly higher Ki-67 expression in their HUT (hyperplasia of usual type)foci compared with controls
11783017 Ki-67 antigen overexpressioin is an early event in esophageal carcinogenesis and useful biomarkers for early detection.
11759064 Use of tissue microarray technique shows immunohistochemical tumor heterogeneity in expression levels of Ki-67 in malignant fibrous histiocytoma cells.
11744991 Not significantly correlated with lymph node metastasis of breast invasive ductal carcinoma.
11570981 There is no significant correlation between Ki-67 labelling index and tumor size of anterior pituitary adenomas, even if this index can be considered a useful marker in the determination of the infiltrative behavior of these tumors.

AA Sequence

MWPTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQ      1 - 70
VNGSVIDEPVRLKHGDVITIIDRSFRYENESLQNGRKSTEFPRKIREQEPARRVSRSSFSSDPDEKAQDS     71 - 140
KAYSKITEGKVSGNPQVHIKNVKEDSTADDSKDSVAQGTTNVHSSEHAGRNGRNAADPISGDFKEISSVK    141 - 210
LVSRYGELKSVPTTQCLDNSKKNESPFWKLYESVKKELDVKSQKENVLQYCRKSGLQTDYATEKESADGL    211 - 280
QGETQLLVSRKSRPKSGGSGHAVAEPASPEQELDQNKGKGRDVESVQTPSKAVGASFPLYEPAKMKTPVQ    281 - 350
YSQQQNSPQKHKNKDLYTTGRRESVNLGKSEGFKAGDKTLTPRKLSTRNRTPAKVEDAADSATKPENLSS    351 - 420
KTRGSIPTDVEVLPTETEIHNEPFLTLWLTQVERKIQKDSLSKPEKLGTTAGQMCSGLPGLSSVDINNFG    421 - 490
DSINESEGIPLKRRRVSFGGHLRPELFDENLPPNTPLKRGEAPTKRKSLVMHTPPVLKKIIKEQPQPSGK    491 - 560
QESGSEIHVEVKAQSLVISPPAPSPRKTPVASDQRRRSCKTAPASSSKSQTEVPKRGGRKSGNLPSKRVS    561 - 630
ISRSQHDILQMICSKRRSGASEANLIVAKSWADVVKLGAKQTQTKVIKHGPQRSMNKRQRRPATPKKPVG    631 - 700
EVHSQFSTGHANSPCTIIIGKAHTEKVHVPARPYRVLNNFISNQKMDFKEDLSGIAEMFKTPVKEQPQLT    701 - 770
STCHIAISNSENLLGKQFQGTDSGEEPLLPTSESFGGNVFFSAQNAAKQPSDKCSASPPLRRQCIRENGN    771 - 840
VAKTPRNTYKMTSLETKTSDTETEPSKTVSTANRSGRSTEFRNIQKLPVESKSEETNTEIVECILKRGQK    841 - 910
ATLLQQRREGEMKEIERPFETYKENIELKENDEKMKAMKRSRTWGQKCAPMSDLTDLKSLPDTELMKDTA    911 - 980
RGQNLLQTQDHAKAPKSEKGKITKMPCQSLQPEPINTPTHTKQQLKASLGKVGVKEELLAVGKFTRTSGE    981 - 1050
TTHTHREPAGDGKSIRTFKESPKQILDPAARVTGMKKWPRTPKEEAQSLEDLAGFKELFQTPGPSEESMT   1051 - 1120
DEKTTKIACKSPPPESVDTPTSTKQWPKRSLRKADVEEEFLALRKLTPSAGKAMLTPKPAGGDEKDIKAF   1121 - 1190
MGTPVQKLDLAGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVD   1191 - 1260
TPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPKPSVGEEKDIIIFVGTPVQKLDLTENLTGSK   1261 - 1330
RRPQTPKEEAQALEDLTGFKELFQTPGHTEEAVAAGKTTKMPCESSPPESADTPTSTRRQPKTPLEKRDV   1331 - 1400
QKELSALKKLTQTSGETTHTDKVPGGEDKSINAFRETAKQKLDPAASVTGSKRHPKTKEKAQPLEDLAGL   1401 - 1470
KELFQTPVCTDKPTTHEKTTKIACRSQPDPVDTPTSSKPQSKRSLRKVDVEEEFFALRKRTPSAGKAMHT   1471 - 1540
PKPAVSGEKNIYAFMGTPVQKLDLTENLTGSKRRLQTPKEKAQALEDLAGFKELFQTRGHTEESMTNDKT   1541 - 1610
AKVACKSSQPDPDKNPASSKRRLKTSLGKVGVKEELLAVGKLTQTSGETTHTHTEPTGDGKSMKAFMESP   1611 - 1680
KQILDSAASLTGSKRQLRTPKGKSEVPEDLAGFIELFQTPSHTKESMTNEKTTKVSYRASQPDLVDTPTS   1681 - 1750
SKPQPKRSLRKADTEEEFLAFRKQTPSAGKAMHTPKPAVGEEKDINTFLGTPVQKLDQPGNLPGSNRRLQ   1751 - 1820
TRKEKAQALEELTGFRELFQTPCTDNPTTDEKTTKKILCKSPQSDPADTPTNTKQRPKRSLKKADVEEEF   1821 - 1890
LAFRKLTPSAGKAMHTPKAAVGEEKDINTFVGTPVEKLDLLGNLPGSKRRPQTPKEKAKALEDLAGFKEL   1891 - 1960
FQTPGHTEESMTDDKITEVSCKSPQPDPVKTPTSSKQRLKISLGKVGVKEEVLPVGKLTQTSGKTTQTHR   1961 - 2030
ETAGDGKSIKAFKESAKQMLDPANYGTGMERWPRTPKEEAQSLEDLAGFKELFQTPDHTEESTTDDKTTK   2031 - 2100
IACKSPPPESMDTPTSTRRRPKTPLGKRDIVEELSALKQLTQTTHTDKVPGDEDKGINVFRETAKQKLDP   2101 - 2170
AASVTGSKRQPRTPKGKAQPLEDLAGLKELFQTPICTDKPTTHEKTTKIACRSPQPDPVGTPTIFKPQSK   2171 - 2240
RSLRKADVEEESLALRKRTPSVGKAMDTPKPAGGDEKDMKAFMGTPVQKLDLPGNLPGSKRWPQTPKEKA   2241 - 2310
QALEDLAGFKELFQTPGTDKPTTDEKTTKIACKSPQPDPVDTPASTKQRPKRNLRKADVEEEFLALRKRT   2311 - 2380
PSAGKAMDTPKPAVSDEKNINTFVETPVQKLDLLGNLPGSKRQPQTPKEKAEALEDLVGFKELFQTPGHT   2381 - 2450
EESMTDDKITEVSCKSPQPESFKTSRSSKQRLKIPLVKVDMKEEPLAVSKLTRTSGETTQTHTEPTGDSK   2451 - 2520
SIKAFKESPKQILDPAASVTGSRRQLRTRKEKARALEDLVDFKELFSAPGHTEESMTIDKNTKIPCKSPP   2521 - 2590
PELTDTATSTKRCPKTRPRKEVKEELSAVERLTQTSGQSTHTHKEPASGDEGIKVLKQRAKKKPNPVEEE   2591 - 2660
PSRRRPRAPKEKAQPLEDLAGFTELSETSGHTQESLTAGKATKIPCESPPLEVVDTTASTKRHLRTRVQK   2661 - 2730
VQVKEEPSAVKFTQTSGETTDADKEPAGEDKGIKALKESAKQTPAPAASVTGSRRRPRAPRESAQAIEDL   2731 - 2800
AGFKDPAAGHTEESMTDDKTTKIPCKSSPELEDTATSSKRRPRTRAQKVEVKEELLAVGKLTQTSGETTH   2801 - 2870
TDKEPVGEGKGTKAFKQPAKRKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELSQTPGHTEELANGAAD   2871 - 2940
SFTSAPKQTPDSGKPLKISRRVLRAPKVEPVGDVVSTRDPVKSQSKSNTSLPPLPFKRGGGKDGSVTGTK   2941 - 3010
RLRCMPAPEEIVEELPASKKQRVAPRARGKSSEPVVIMKRSLRTSAKRIEPAEELNSNDMKTNKEEHKLQ   3011 - 3080
DSVPENKGISLRSRRQNKTEAEQQITEVFVLAERIEINRNEKKPMKTSPEMDIQNPDDGARKPIPRDKVT   3081 - 3150
ENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQ   3151 - 3220
RVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI                                     3221 - 3256
//

Text Mined References (577)

PMID Year Title
27363060 2016 Value of p16(INK4a) and Ki-67 Immunohistochemical Staining in Cervical Intraepithelial Neoplasia Grade 2 Biopsies as Biomarkers for Cervical Intraepithelial Neoplasia Grade 3 in Cone Results.
27362226 2016 Ki-67 acts as a biological surfactant to disperse mitotic chromosomes.
27276745 2016 Correlation between Serum SCCA and CYFRA 2 1-1, Tissue Ki-67, and Clinicopathological Factors in Patients with Esophageal Squamous Cell Carcinoma.
27197423 2016 PTTG and Ki-67 expression in pituitary adenomas.
27182675 2016 Value of Ki-67 and computed tomography in the assessment of peripheral lung adenocarcinoma.
27012044 2016 High Ki67 Expression has Prognostic Value in Surgically-Resected T3 Gastric Adenocarcinoma.
26978017 [Prognostic values of the clinical, morphological and molecular biological characteristics of colon adenocarcinoma].
26964379 2016 The expression and significance of p53 protein and Ki-67 protein in pterygium.
26963620 2016 Breastfeeding and Immunohistochemical Expression of ki-67, p53 and BCL2 in Infiltrating Lobular Breast Carcinoma.
26954364 2016 Risk Factors Associated with Discordant Ki-67 Levels between Preoperative Biopsy and Postoperative Surgical Specimens in Breast Cancers.
26926679 2016 Prognostic Value of Ki-67 Index, Cytology, and Growth Pattern in Mantle-Cell Lymphoma: Results From Randomized Trials of the European Mantle Cell Lymphoma Network.
26911364 2016 Extended resection including adjacent organs and Ki-67 labeling index are prognostic factors in patients with retroperitoneal soft tissue sarcomas.
26818835 2016 Bimodality of intratumor Ki67 expression is an independent prognostic factor of overall survival in patients with invasive breast carcinoma.
26786263 2016 High Proliferation Predicts Pathological Complete Response to Neoadjuvant Chemotherapy in Early Breast Cancer.
26743291 2015 Ki-67 and p53 immunostaining assessment of proliferative activity in salivary tumors.
26743285 2015 Changes in immunoexpression of p53, Ki-67, Ets-1, APAF-1 and PTEN in serrated and conventional colon adenomas.
26722504 2015 Expression of MTA2 and Ki-67 in hepatocellular carcinoma and their correlation with prognosis.
26708185 2015 High temperature requirement A1, transforming growth factor beta1, phosphoSmad2 and Ki67 in eutopic and ectopic endometrium of women with endometriosis.
26680267 2016 The assessment of Ki-67 as a prognostic marker in neuroendocrine tumours: a systematic review and meta-analysis.
26633571 2016 The Genomic Grade Assay Compared With Ki67 to Determine Risk of Distant Breast Cancer Recurrence.
26619927 2016 Prognostic value of Ki-67 in solid pseudopapillary tumor of the pancreas: Huashan experience and systematic review of the literature.
26593398 2015 EZH2 is highly expressed in pituitary adenomas and associated with proliferation.
26546525 Suppression of BCL2 by Antisense Oligonucleotides and Compensation by Non-Targeted Genes May Enhance Tumor Proliferation.
26512778 2015 Ki67/SATB1 ratio is an independent prognostic factor of overall survival in patients with early hormone receptor-positive invasive ductal breast carcinoma.
26472563 2015 Prognostic significance of proline, glutamic acid, leucine rich protein 1 (PELP1) in triple-negative breast cancer: a retrospective study on 129 cases.
26459875 2015 Ki-67 labeling index affects tumor infiltration patterns of lung squamous cell carcinoma.
26458958 2016 Evaluation of an epithelial plasticity biomarker panel in men with localized prostate cancer.
26456310 2015 Correlations between ADC values and molecular markers of Ki-67 and HIF-1? in hepatocellular carcinoma.
26448927 2015 Ki-67 Expression in CRC Lymph Node Metastasis Does Not Predict Survival.
26423666 2015 Expression and Significance of COX-2 and Ki-67 in Hepatolithiasis with Bile Duct Carcinoma.
26420767 2016 The importance of tissue handling of surgically removed breast cancer for an accurate assessment of the Ki-67 index.
26345794 2015 Study on the correlation between the expression of Ki67 and FasL and prognosis of cervical carcinoma.
26338964 2015 IDH1/2 mutation status combined with Ki-67 labeling index defines distinct prognostic groups in glioma.
26317313 2016 Her2 and Ki67 Biomarkers Predict Recurrence of Ductal Carcinoma in Situ.
26281861 2016 High Ki67 expression is an independent good prognostic marker in colorectal cancer.
26261629 2015 Detecting of gastric cancer by Bcl-2 and Ki67.
26241661 2015 Distinguishing Low-Risk Luminal A Breast Cancer Subtypes with Ki-67 and p53 Is More Predictive of Long-Term Survival.
26230097 2015 The Accuracy of p16/Ki-67 and HPV Test in the Detection of CIN2/3 in Women Diagnosed with ASC-US or LSIL.
26214624 Importance of Ki-67 in human epidermal growth factor receptor 2 positive breast cancer.
26206765 2015 The region-of-interest size impacts on Ki67 quantification by computer-assisted image analysis in breast cancer.
26188382 2016 Thyroid Hürthle cell tumors: research of potential markers of malignancy.
26174366 2015 Ki-67 as a prognostic marker in early-stage non-small cell lung cancer in Asian patients: a meta-analysis of published studies involving 32 studies.
26171918 2015 MIB-1 Index as a Surrogate for Mitosis-Karyorrhexis Index in Neuroblastoma.
26107196 2015 Ki-67 Can Predict the Response to the Gemcitabine, Oxaliplatin And L-asparaginase Regimen (GELOX) and Prognosis in Patients with Nasal Natural Killer/T-cell Lymphoma.
26078569 2015 Prognostic angiogenic markers (endoglin, VEGF, CD31) and tumor cell proliferation (Ki67) for gastrointestinal stromal tumors.
26076967 2015 Association between androgen receptor expression, Ki-67 and the 21-gene recurrence score in non-metastatic, lymph node-negative, estrogen receptor-positive and HER2-negative breast cancer.
26070608 2015 Comparison of digital image analysis and visual scoring of KI-67 in prostate cancer prognosis after prostatectomy.
26060263 2015 Menstrual cycle could affect Ki67 expression in estrogen receptor-positive breast cancer patients.
26039245 2015 Androgen Receptor (AR), E-Cadherin, and Ki-67 as Emerging Targets and Novel Prognostic Markers in Triple-Negative Breast Cancer (TNBC) Patients.
26017881 2015 Evaluation of different p16 immunostaining methods and the prognostic role of p16/Ki-67 combined expression in non-muscle invasive bladder cancers.
26017878 2015 Severe dysplasia can be distinguished from moderate and mild dysplasia of bronchial mucosa by changes in Ki-67 index.
25967708 2015 Relationship between CD4+CD25+ Treg and expression of HIF-1? and Ki-67 in NSCLC patients.
25932921 2015 An interobserver reproducibility analysis of Ki67 visual assessment in breast cancer.
25879558 2015 Mechanisms of resistance in patients with chronic myeloid leukemia treated with tyrosine kinase inhibitors.
25863475 2015 Ki-67 expression in sclerosing adenosis and adjacent normal breast terminal ductal lobular units: a nested case-control study from the Mayo Benign Breast Disease Cohort.
25845386 2015 Mitochondrial DNA alterations correlate with the pathological status and the immunological ER, PR, HER-2/neu, p53 and Ki-67 expression in breast invasive ductal carcinoma.
25835106 2015 P53, KI-67, CD117 expression in gastrointestinal and pancreatic neuroendocrine tumours and evaluation of their correlation with clinicopathological and prognostic parameters.
25807305 2015 The prognostic role of Ki-67/MIB-1 in cervical cancer: a systematic review with meta-analysis.
25790540 2015 Clinicopathological importance of Ki-67, p27, and p53 expression in gastric cancer.
25778295 Neoadjuvant chemotherapy-induced changes in immunohistochemical expression of estrogen receptor, progesterone receptor, HER2, and Ki-67 in patients with breast cancer.
25777091 2015 Immunohistochemical Evaluation of Minichromosome Maintenance Protein 7 (MCM7), Topoisomerase II?, and Ki-67 in Diffuse Malignant Peritoneal Mesothelioma Patients Using Tissue Microarray.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25743839 2015 Expression of ki67 in papillary thyroid microcarcinoma and its clinical significance.
25712457 2015 Ki-67 is a strong predictor of central nervous system relapse in patients with mantle cell lymphoma (MCL).
25711229 2015 Co-Expression of p16, Ki67 and COX-2 Is Associated with Basal Phenotype in High-Grade Ductal Carcinoma In Situ of the Breast.
25684532 2015 Relation between Ki-67, ER, PR, Her2/neu, p21, EGFR, and TOP II-? expression in invasive ductal breast cancer patients and correlations with prognosis.
25684464 2015 Ki-67 is a valuable prognostic factor in gliomas: evidence from a systematic review and meta-analysis.
25673730 2015 Visual assessment of Ki67 using a 5-grade scale (Eye-5) is easy and practical to classify breast cancer subtypes with high reproducibility.
25657202 2015 Immunohistochemical validation of overexpressed genes identified by global expression microarrays in adrenocortical carcinoma reveals potential predictive and prognostic biomarkers.
25648135 2015 Bcl2 and Ki67 refine prognostication in luminal breast cancers.
25633038 2015 Ki67 index is an independent prognostic factor in epithelioid but not in non-epithelioid malignant pleural mesothelioma: a multicenter study.
25600243 2015 High Ki-67 Expression and Low Progesterone Receptor Expression Could Independently Lead to a Worse Prognosis for Postmenopausal Patients With Estrogen Receptor-Positive and HER2-Negative Breast Cancer.
25595275 2015 Expression of proliferation markers Ki67, cyclin A, geminin and aurora-kinase A in primary breast carcinomas and corresponding distant metastases.
25573205 2015 Prognostic effect of Ki-67 expression in rituximab, cyclophosphamide, doxorubicin, vincristine and prednisone-treated diffuse large B-cell lymphoma is limited to non-germinal center B-cell-like subtype in late-elderly patients.
25556461 2014 Correlation between Ki67 and histological grade in breast cancer patients treated with preoperative chemotherapy.
25547827 2015 Correlations between prognosis and regional biomarker profiles in head and neck squamous cell carcinomas.
25527409 2015 Expression of estrogen receptor ? and Ki 67 in benign & malignant human prostate lesions by immunohistochemistry.
25511212 Cyclin D1 and Ki-67 expression in normal, hyperplastic and neoplastic endometrium.
25504496 2015 High Ki-67 expression in involved bone marrow predicts worse clinical outcome in diffuse large B cell lymphoma patients treated with R-CHOP therapy.
25431344 2015 Computerized image analysis of the Ki-67 proliferation index in mantle cell lymphoma.
25404475 2015 Ki67 Expression has Prognostic Significance in Relation to Human Papillomavirus Status in Oropharyngeal Squamous Cell Carcinoma.
25400769 2014 Prognostic value of Ki67 expression in HR-negative breast cancer before and after neoadjuvant chemotherapy.
25398292 2015 Ki-67 proliferation index in patients with placenta previa percreta in the third trimester.
25384521 2015 Proliferation of trophoblasts and Ki67 expression in preeclampsia.
25381338 2015 Development of circulating tumor cell-endocrine therapy index in patients with hormone receptor-positive breast cancer.
25374203 2014 Distribution of Ki67 proliferative indices among WHO subtypes of non-Hodgkin's lymphoma: association with other clinical parameters.
25339008 2014 Prognostic significance of expression of CD133 and Ki-67 in gastric cancer.
25313763 The expression of MMP-2 and Ki-67 in head and neck melanoma, and their correlation with clinic-pathologic indices.
25313753 Role of Ki-67 labeling index as an adjunct to the histopathological diagnosis and grading of astrocytomas.
25308006 Association of Ki-67 antigen and p53 protein at invasive tumor front of oral squamous cell carcinoma.
25297929 2015 A clinicopathological analysis of primary mucosal malignant melanoma.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25211928 [Prognostic value of ki-67 and vimentin markers in patients with metastatic kidney cancer].
25204411 2014 Prognostic significance of Ki-67 antigen expression in extranodal natural killer/T-cell lymphoma, nasal type.
25195708 2015 Prognostic classification of thyroid follicular cell tumors using Ki-67 labeling index: risk stratification of thyroid follicular cell carcinomas.
25170613 2014 Progesterone receptor status and Ki-67 index may predict early relapse in luminal B/HER2 negative breast cancer patients: a retrospective study.
25149503 2014 Evaluation of p16, human papillomavirus capsid protein L1 and Ki-67 in cervical intraepithelial lesions: potential utility in diagnosis and prognosis.
25120774 2014 Possible prognostic significance of p53, cyclin D1 and Ki-67 in the second primary malignancy of patients with double primary malignancies.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25088936 2014 Variability of Ki67 labeling index in multiple neuroendocrine tumors specimens over the course of the disease.
25029119 2014 Utility of immunohistochemical markers in irradiated breast tissue: an analysis of the role of myoepithelial markers, p53, and Ki-67.
25016269 2014 The role of Ki-67 in women with a resistant prolactinoma: a retrospective analysis in 199 hospitalized patients over a period of 5 years.
25015333 2014 Prognostic significance of miR-34a in Ewing sarcoma is associated with cyclin D1 and ki-67 expression.
25013792 2014 Evaluation of correlation of cell cycle proteins and Ki-67 interaction in paranasal sinus inverted papilloma prognosis and squamous cell carcinoma transformation.
25012947 2014 Diagnostic caveats of immunoreactivity for Ki67 and chromogranin A in hyalinizing trabecular tumour of the thyroid.
25012651 2014 Ki67 antigen contributes to the timely accumulation of protein phosphatase 1? on anaphase chromosomes.
25003838 2014 Biomarkers distinguishing mammary fibroepithelial neoplasms: a tissue microarray study.
24966950 2014 Notch-1 and Ki-67 receptor as predictors for the recurrence and prognosis of Kimura's disease.
24966939 2014 Prognostic value of Ki67 index in gastrointestinal stromal tumors.
24949917 2014 The role of Ki-67 in the proliferation and prognosis of breast cancer molecular classification subtypes.
24934660 2014 A novel model for Ki67 assessment in breast cancer.
24929480 2014 Neoplasms arising in large gastric hyperplastic polyps: endoscopic and pathologic features.
24870756 2014 Associations between mammography and ultrasound imaging features and molecular characteristics of triple-negative breast cancer.
24867636 2014 Ki-67 is a PP1-interacting protein that organises the mitotic chromosome periphery.
24852133 2014 The expression of cell cycle related proteins PCNA, Ki67, p27 and p57 in normal and preeclamptic human placentas.
24834759 2014 Ki67 as a biologic marker of basal cell carcinoma: a retrospective study.
24815448 2014 Expression of Ki-67, p53 and VEGF in pediatric neuroblastoma.
24785530 2015 Genotyping of high-risk human papillomaviruses in p16/Ki-67-positive urothelial carcinoma cells: even a worm will turn.
24783217 2014 Can ki-67 play a role in prediction of breast cancer patients' response to neoadjuvant chemotherapy?
24750272 2014 Pancreatic neuroendocrine tumour grading on endoscopic ultrasound-guided fine needle aspiration: high reproducibility and inter-observer agreement of the Ki-67 labelling index.
24717877 The immunoexpression of CD34, Bcl-2, and Ki-67 antigens in sinonasal inverted papillomas.
24715164 2014 Immunohistochemical study of Ki67, CD34 and p53 expression in human tooth buds.
24708745 2014 A methodology to ensure and improve accuracy of Ki67 labelling index estimation by automated digital image analysis in breast cancer tissue.
24642606 2014 p16/Ki-67 dual-stained cytology testing may predict postpartum outcome in patients with abnormal papanicolaou cytology during pregnancy.
24627004 2014 Ki-67 as an independent prognostic factor in an unselected cohort of patients with ovarian cancer: results of an explorative, retrospective study.
24624938 2014 Expression of topoisomerase II alpha, ki67, and p53 in primary non-muscle-invasive urothelial bladder carcinoma.
24610618 2014 Expression of cyclinD1 and Ki-67 proteins in gliomas and its clinical significance.
24597851 2014 Ki-67 is a valuable prognostic predictor of lymphoma but its utility varies in lymphoma subtypes: evidence from a systematic meta-analysis.
24586570 2014 Estrogen receptor-negative breast ductal carcinoma: clinicopathological features and MIB-1 (Ki-67) proliferative index association.
24585679 2014 18-Fluorine fluorodeoxyglucose positron emission tomography in the pretreatment evaluation of thymic epithelial neoplasms: a metabolic biopsy confirmed by Ki-67 expression.
24577133 2014 Prognostic significance of Ki67 proliferation index, HIF1 alpha index and microvascular density in patients with non-small cell lung cancer brain metastases.
24553861 2015 Clinicopathological significance of androgen receptor, HER2, Ki-67 and EGFR expressions in salivary duct carcinoma.
24507671 2014 Correlations of ?-catenin, Ki67 and Her-2/neu with gastric cancer.
24505696 2013 An integrated framework for automatic Ki-67 scoring in pancreatic neuroendocrine tumor.
24498305 2014 Prognostic value of Ki-67 in breast cancer patients with positive axillary lymph nodes: a retrospective cohort study.
24486077 2014 Prostate cancer Ki-67 (MIB-1) expression, perineural invasion, and gleason score as biopsy-based predictors of prostate cancer mortality: the Mayo model.
24452592 2014 Nonfunctioning pituitary adenomas: association of Ki-67 and HMGA-1 labeling indices with residual tumor growth.
24403473 2014 Association between tumor size and immunohistochemical expression of Ki-67, p53 and BCL2 in a node-negative breast cancer population selected from a breast cancer screening program.
24403472 2014 Prognostic significance of Ki-67 in chemotherapy-naive breast cancer patients with 10-year follow-up.
24403187 2014 The prognostic value of Ki67 in systemically untreated patients with node-negative breast cancer.
24384677 2014 Characterizing invading glioma cells based on IDH1-R132H and Ki-67 immunofluorescence.
24373696 2014 Developmental patterns of Ki-67, Oct-4 and ?-tubulin proteins expression in the human spinal cord.
24369532 2013 Chromogenic in situ hybridization and p16/Ki67 dual staining on formalin-fixed paraffin-embedded cervical specimens: correlation with HPV-DNA test, E6/E7 mRNA test, and potential clinical applications.
24360660 2014 Ki-67 is an independent indicator in non-muscle invasive bladder cancer (NMIBC); combination of EORTC risk scores and Ki-67 expression could improve the risk stratification of NMIBC.
24344040 In vitro study on the effect of doxorubicin on the proliferation markers MCM3 and Ki-67.
24344030 CDC25B, Ki-67, and p53 expressions in reactive gliosis and astrocytomas.
24324728 2013 The prognostic value of mitotic activity index (MAI), phosphohistone H3 (PPH3), cyclin B1, cyclin A, and Ki67, alone and in combinations, in node-negative premenopausal breast cancer.
24322019 2013 Immunofluorescence expression of Ki-67, p53 and cyclin inhibitors (p16ink4a, p21 and p27) in low-grade cervical lesions versus high-grade cervical lesions. Research study on cell cultures.
24261348 2015 HPV16 genotype, p16/Ki-67 dual staining and koilocytic morphology as potential predictors of the clinical outcome for cervical low-grade squamous intraepithelial lesions.
24207090 2013 Role of Ki67 in predicting resistance to adjuvant tamoxifen in postmenopausal breast cancer patients.
24200480 2013 Diffusion-weighted imaging of prostate cancer on 3T MR: Relationship between apparent diffusion coefficient values and Ki-67 expression.
24196303 2014 Ki-67 and p53 expression of the fallopian tube mucosa in breast cancer patients with hereditary risk.
24189270 2014 Quantitative assessment Ki-67 score for prediction of response to neoadjuvant chemotherapy in breast cancer.
24185119 2014 The value of immunohistochemical determination of topoisomerase II? and Ki67 as markers of cell proliferation and malignant transformation in colonic mucosa.
24151431 2013 Immunostaining of p16(INK4a)/Ki-67 and L1 capsid protein on liquid-based cytology specimens obtained from ASC-H and LSIL-H cases.
24121170 2013 Grading of well-differentiated pancreatic neuroendocrine tumors is improved by the inclusion of both Ki67 proliferative index and mitotic rate.
24118263 2014 Cytodiagnosis of endometrial carcinoma and hyperplasia on imprint smears with additional immunocytochemistry using Ki-67 and p53 biomarkers.
24083750 2013 Diagnostic value of protein Ki67 (MIB-1) in atypical pap smears of postmenopausal women.
24081504 2013 Dual immunostaining of cervical cytology specimens with atypical squamous cells for p16/Ki-67 does not exclude the existence of a high-grade squamous intraepithelial lesion.
24061459 Immunohistochemical expression of MIB-1 and PCNA in precancerous and cancerous lesions of uterine cervix.
24056649 Importance of P53, Ki-67 expression in the differential diagnosis of benign/malignant phyllodes tumors of the breast.
24051696 2014 Distinguishing luminal breast cancer subtypes by Ki67, progesterone receptor or TP53 status provides prognostic information.
24024498 2013 Tonsil surface epithelium is ideal for monitoring Ki-67 immunohistochemical staining.
24021213 2013 Phosphohistone H3 and Ki-67 labeling indices in cytologic specimens from well-differentiated neuroendocrine tumors of the gastrointestinal tract and pancreas: a comparative analysis using automated image cytometry.
24008660 2013 The prognostic impact of a combined carbonic anhydrase IX and Ki67 signature in oral squamous cell carcinoma.
23986211 Expression of metallothionein and Ki-67 antigen in GISTs of different grade of malignancy.
23982330 2013 Diagnostic and therapeutic strategy and the most efficient prognostic factors of breast malignant fibrous histiocytoma.
23970015 2013 Ki67 levels as predictive and prognostic parameters in pretherapeutic breast cancer core biopsies: a translational investigation in the neoadjuvant GeparTrio trial.
23963898 2014 Immunohistochemical distribution of cell cycle proteins p27, p57, cyclin D3, PCNA and Ki67 in normal and diabetic human placentas.
23902708 2013 Insights into the prognostic value of DJ-1 and MIB-1 in astrocytic tumors.
23846734 2013 p53 is not related to Ki-67 immunostaining in the epithelial and mesenchymal components of female genital tract carcinosarcomas.
23818355 Relationship of TP53 and Ki67 expression in bladder cancer under WHO 2004 classification.
23818347 Evaluation of changes in biologic markers ER, PR, HER 2 and Ki-67 index in breast cancer with administration of neoadjuvant dose dense doxorubicin, cyclophosphamide followed by paclitaxel chemotherapy.
23818346 Prognostic significance of estrogen receptor, progesterone receptor, HER2/neu, Ki-67, and nm23 expression in patients with invasive breast cancer.
23818345 The role of ThinPrep cytology in the investigation of ki-67 index, p53 and HER-2 detection in fine-needle aspirates of breast tumors.
23812670 2013 Ki67 measured after neoadjuvant chemotherapy for primary breast cancer.
23805466 [Ki-67 and matrix metalloproteinase-9 expression in the follicular cyst, keratocystic odontogenic tumor, and ameloblastoma].
23790165 2013 Expression of Ki-67 and p53 in meningiomas.
23729443 2013 Antibody-secreting cells with a phenotype of Ki-67low, CD138high, CD31high, and CD38high secrete nonspecific IgM during primary hepatitis A virus infection.
23729350 2014 Utility of Ki-67, p53, Bcl-2, and Cox-2 biomarkers for low-grade endometrial cancer and disordered proliferative/benign hyperplastic endometrium by imprint cytology.
23721782 2013 Increased Ki-67 immunoreactivity in the white matter in hemimegalencephaly.
23718721 Immunoreactivity of p53 and Ki-67 for dysplastic changes in children with eosinophilic esophagitis.
23674848 2013 Overexpression of carbonic anhydrase II and Ki-67 proteins in prognosis of gastrointestinal stromal tumors.
23674192 2013 Ki-67 is a prognostic parameter in breast cancer patients: results of a large population-based cohort of a cancer registry.
23643983 2013 Identifying Ki-67 specific miRNA-mRNA interactions in malignant astrocytomas.
23614934 2013 Prediction of BRCA1 germ-line mutation status in patients with breast cancer using histoprognosis grade, MS110, Lys27H3, vimentin, and KI67.
23594232 2013 Prognostic value of tissue protein expression levels of MIB-1 (Ki-67) in Danish ovarian cancer patients. From the 'MALOVA' ovarian cancer study.
23579216 2013 A comparison of Ki-67 and mitotic count as prognostic markers for metastatic pancreatic and midgut neuroendocrine neoplasms.
23550775 2013 Phosphohistone-H3 and Ki-67 immunostaining in cutaneous pilar leiomyoma and leiomyosarcoma (atypical intradermal smooth muscle neoplasm).
23545927 2013 Assessment of syndecan-1 (CD138) and Ki-67 expression for differentiating keratoacanthoma and squamous cell carcinoma.
23526930 2013 Long-term prognostic performance of Ki67 rate in early stage, pT1-pT2, pN0, invasive breast carcinoma.
23511287 Donor site healing dynamics: molecular, histological, and noninvasive imaging assessment in a porcine model.
23509992 2014 Can we improve the clinical risk score? The prognostic value of p53, Ki-67 and thymidylate synthase in patients undergoing radical resection of colorectal liver metastases.
23382998 2013 New insight into Ki67 expression at the invasive front in breast cancer.
23382631 2013 Role of Ki-67 as a prognostic factor in gastrointestinal stromal tumors.
23359198 2012 Expression of Ki-67 (MIB-1) and GLUT-1 proteins in non-advanced prostatic cancer.
23343959 2013 Expression and prognostic significance of livin, caspase-3, and ki-67 in the progression of human ampullary carcinoma.
23301386 2012 Is the immunohistochemical expression of proliferation (Ki-67) and apoptosis (Bcl-2) markers and cyclooxigenase-2 (COX-2) related to carcinogenesis in postmenopausal endometrial polyps?
23286956 2013 [Ki67 in young patients with breast cancer].
23266046 2013 High tissue density of FOXP3+ T cells is associated with clinical outcome in prostate cancer.
23244127 2012 Expression of Ki67 and CD105 as proliferation and angiogenesis markers in salivary gland tumors.
23240716 2013 Variability in morphology and cell proliferation in sequential biopsies of mantle cell lymphoma at diagnosis and relapse: clinical correlation and insights into disease progression.
23235554 2013 Retrospective analysis of risk factors for central nervous system metastases in operable breast cancer: effects of biologic subtype and Ki67 overexpression on survival.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184081 2013 Different prognostic significance of Ki-67 change between pre- and post-neoadjuvant chemotherapy in various subtypes of breast cancer.
23178126 2012 Microcephaly gene links trithorax and REST/NRSF to control neural stem cell proliferation and differentiation.
23139965 2012 The prognostic value of the P53 protein and the Ki67 marker in breast cancer patients.
23137549 2013 Clinical impact of ki-67 labeling index in non-small cell lung cancer.
23135572 2013 Validity of the proliferation markers Ki67, TOP2A, and RacGAP1 in molecular subgroups of breast cancer.
23096218 2013 Prognostic significance of RACGAP1 mRNA expression in high-risk early breast cancer: a study in primary tumors of breast cancer patients participating in a randomized Hellenic Cooperative Oncology Group trial.
23042264 2012 Expression of metallothionein I/II and Ki-67 antigen in various histological types of basal cell carcinoma.
23040923 2012 Comparison of Ki-67 proliferative index between eutopic and ectopic endometrium: a case control study.
23030583 2013 Immunohistological expression of HIF-1?, GLUT-1, Bcl-2 and Ki-67 in consecutive biopsies during chemoradiotherapy in patients with rectal cancer.
23026928 2012 Objective quantification of the Ki67 proliferative index in neuroendocrine tumors of the gastroenteropancreatic system: a comparison of digital image analysis with manual methods.
23016458 2012 A framework for quantitative assessment of Ki67 distribution in preneoplastic bronchial epithelial lesions.
23003335 2013 p16(INK4a) /Ki-67 dual labelling as a marker for the presence of high-grade cancer cells or disease progression in urinary cytopathology.
22995634 2012 Impact of the epithelial dysplasia grading and Ki67 proliferation index in the adjacent non-malignant mucosa on recurrence and survival in head and neck squamous cell carcinoma.
22976139 2012 Ki-67 expression for predicting progression of postoperative residual pituitary adenomas: correlations with clinical variables.
22939959 2013 Ki-67 expression in axillary lymph node metastases in breast cancer is prognostically significant.
22932087 2012 Expression of Ki-67, galectin-3, fragile histidine triad, and parafibromin in malignant and benign parathyroid tumors.
22901702 2012 Biologic correlation between glucose transporters, hexokinase-II, Ki-67 and FDG uptake in malignant melanoma.
22892062 2012 Basal Ki67 expression measured by digital image analysis is optimal for prognostication in oral squamous cell carcinoma.
22890751 2012 Ki67 expression in the primary tumor predicts for clinical benefit and time to progression on first-line endocrine therapy in estrogen receptor-positive metastatic breast cancer.
22886115 2012 A clinicopathologic study of Ki-67 proliferation index in colorectal carcinoma.
22783570 2012 The use of a combination of Ki-67, Galectin-3, and PTTG can distinguish the benign and malignant thyroid tumor.
22778705 2012 Ki-67 and MCM-2 in dental follicle and odontogenic cysts: the effects of inflammation on proliferative markers.
22752375 2012 Ki-67 is a prognostic biomarker of survival after radiofrequency ablation of liver malignancies.
22734595 2012 Patterns of failure after multimodal treatments for high-grade glioma: effectiveness of MIB-1 labeling index.
22675168 2012 Performance of p16/Ki-67 immunostaining to detect cervical cancer precursors in a colposcopy referral population.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22639545 2012 Keratocystic odontogenic tumors: predictive factors of recurrence by Ki-67 and AgNOR labelling.
22631655 2012 Role of centromere protein H and Ki67 in relapse-free survival of patients after primary surgery for hypopharyngeal cancer.
22590818 2012 Hormone receptors expression in phyllodes tumors of the breast.
22575865 2012 Limited role of Ki-67 proliferative index in predicting overall short-term survival in patients with typical and atypical pulmonary carcinoid tumors.
22554964 2012 Scoring the percentage of Ki67 positive nuclei is superior to mitotic count and the mitosis marker phosphohistone H3 (PHH3) in terms of differentiating flat lesions of the bladder mucosa.
22542077 2012 Clinicopathologic correlation of vitamin D receptor expression with retinoid X receptor and MIB-1 expression in primary and metastatic osteosarcoma.
22534537 Clinical significance of Smac and Ki-67 expression in pancreatic cancer.
22531522 Correlation of fluorodeoxyglucose uptake and tumor-proliferating antigen Ki-67 in lymphomas.
22520514 2012 A retrospective analysis of the clinicopathologic characteristics of uterine cellular leiomyomas in China.
22499302 Immunohistochemical study of osteopontin, Ki-67, and CD34 of psoriasis in Mansoura, Egypt.
22492957 2012 Interplay among BRAF, p16, p53, and MIB1 in pediatric low-grade gliomas.
22452996 2012 Hypoxia-inducible factor-2a is associated with ABCG2 expression, histology-grade and Ki67 expression in breast invasive ductal carcinoma.
22419713 2012 Expression of Ki-67, PTTG1, FGFR4, and SSTR 2, 3, and 5 in nonfunctioning pituitary adenomas: a high throughput TMA, immunohistochemical study.
22395508 2012 P53, Bcl-2 and Ki67 immunoexpression in follicular solid ameloblastomas.
22395505 2012 P53, p16 and Ki67 immunoexpression in oral squamous carcinomas.
22378020 2012 The effect of NET-1 on the proliferation, migration and endocytosis of the SMMC-7721 HCC cell line.
22372356 2012 The use of an immunocytochemical double-labeling staining can display the distribution of Bcl-2/Ki-67 cells in endometrial adenocarcinomas as well as in normal endometrium.
22361634 2012 HER2/neu and Ki-67 expression predict non-invasive recurrence following breast-conserving therapy for ductal carcinoma in situ.
22335907 2011 [Correlation between loss of heterozygosity on chromosome 1p and 19q and expression of MGMT, p53 and Ki-67 proteins in gliomas].
22335622 2012 Prognostic value of Ki67 index in anaplastic oligodendroglial tumours--a translational study of the European Organization for Research and Treatment of Cancer Brain Tumor Group.
22309998 2011 Prognostic significance of angiogenesis in relation to Ki-67, p-53, p-27, and bcl-2 expression in embryonal tumors.
22300665 2012 EGFR, CD10 and proliferation marker Ki67 expression in ameloblastoma: possible role in local recurrence.
22277792 2012 Evaluation of apoptosis along with BCL-2 and Ki-67 expression in patients with intestinal metaplasia.
22248824 2011 Prognostic impact of Ki-67 overexpression in subgroups categorized according to St. Gallen with early stage breast cancer.
22205326 2012 Risk factors for disease progression in advanced jejunoileal neuroendocrine tumors.
22199292 2011 The expression of Ki-67, but not proliferating cell nuclear antigen, predicts poor disease free survival in patients with adenocarcinoma of the lung.
22197541 2012 Significance of Ki-67 and p53 immunoexpression in the differential diagnosis of oral necrotizing sialometaplasia and squamous cell carcinoma.
22172851 2011 Effects of risk factors and Ki-67 on rates of recurrence on patients who have undergone liver transplant for hepatocellular carcinoma.
22169637 2011 [Clinicopathologic study and immunohistochemistry comparison of Pax2, p53 and Ki-67 in low- and high-grade ovarian serous carcinomas].
22147251 2012 Increased expression of VEGF, COX-2, and Ki-67 in Barrett's esophagus: does the length matter?
22126395 2011 Advantages of adjuvant chemotherapy for patients with triple-negative breast cancer at Stage II: usefulness of prognostic markers E-cadherin and Ki67.
22125028 2012 Analysis of human Ki-67 gene promoter and identification of the Sp1 binding sites for Ki-67 transcription.
22043024 2011 Claudins and ki-67: potential markers to differentiate low- and high-grade transitional cell carcinomas of the urinary bladder.
22040408 2011 Relationship between magnetic resonance imaging and molecular pathology in patients with glioblastoma multiforme.
22040407 2011 Gene expression profiling reveals Ki-67 associated proliferation signature in human glioblastoma.
22024151 2011 Exon 11 mutations, Ki67, and p16(INK4A) as predictors of prognosis in patients with GIST.
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.
21979598 2011 Diagnostic implications of L1, p16, and Ki-67 proteins and HPV DNA in low-grade cervical intraepithelial neoplasia.
21965052 2013 Expression of Ki-67 as proliferation biomarker in imprint smears of endometrial carcinoma.
21960707 2011 Assessment of Ki67 in breast cancer: recommendations from the International Ki67 in Breast Cancer working group.
21937080 2012 Ki-67 proliferative index predicts progression-free survival of patients with well-differentiated ileal neuroendocrine tumors.
21935871 2011 Morphological evaluation of parathyroid adenomas and immunohistochemical analysis of PCNA and Ki-67 proliferation markers.
21881319 2011 Ki-67 labeling index is associated with recurrence after segmentectomy under video-assisted thoracoscopic surgery in stage I non-small cell lung cancer.
21840910 2011 Expression patterns of Aurora A and B kinases, Ki-67 and the estrogen and progesterone receptors determined using an endometriosis tissue microarray model.
21819622 2011 Ki67 proliferation in core biopsies versus surgical samples - a model for neo-adjuvant breast cancer studies.
21809665 2011 [Ki-67 expression, thymidine phosphorylase and PTEN in intraepithelial cervical carcinoma].
21792693 2011 MGMT immunoexpression in growth hormone-secreting pituitary adenomas and its correlation with Ki-67 labeling index and cytokeratin distribution pattern.
21778791 2011 Frequent upregulation of cyclin D1 and p16 expression with low Ki-67 scores in multinucleated giant cells.
21753697 2011 Giant pituitary adenomas: pathologic-radiographic correlations and lack of role for p53 and MIB-1 labeling.
21738398 2011 Expression of cell proliferation and apoptosis biomarkers in pterygia and normal conjunctiva.
21694464 2010 Diagnostic and prognostic tissuemarkers in clear cell and papillary renal cell carcinoma.
21680106 2011 Differential expression of DUSP6 with expression of ERK and Ki-67 in non-small cell lung carcinoma.
21677540 2011 Gastric pit dysplasia in adjacent gastric mucosa in 414 gastric cancers: prevalence and characteristics.
21664839 2013 Prognostic value of carbonic anhydrase IX expression in penile squamous cell carcinoma: a pilot study.
21655657 2011 P16, c-erbB2 and Ki67 immunoexpression in urothelial carcinomas of the bladder.
21655654 2011 Endometrial carcinomas: correlation between ER, PR, Ki67 status and histopathological prognostic parameters.
21655651 2011 CD105/Ki67 double immunostaining expression in liver metastasis from colon carcinoma.
21652010 2011 Increase of Ki-67+ natural killer cells in multiple sclerosis patients treated with interferon-? and interferon-? combined with low-dose oral steroids.
21642658 2011 Prognostic molecular markers in women aged 35 years or younger with breast cancer: is there a difference from the older patients?
21629784 2011 A tri-marker proliferation index predicts biochemical recurrence after surgery for prostate cancer.
21611785 2011 p53 regulates Ki-67 promoter activity through p53- and Sp1-dependent manner in HeLa cells.
21610457 2011 Immunohistochemical double stains against Ki67/MART1 and HMB45/MITF: promising diagnostic tools in melanocytic lesions.
21572399 2011 Tubal metaplasia of the endometrium with cytologic atypia: analysis of p53, Ki-67, TERT, and long-term follow-up.
21524841 2011 MicroRNA-519d targets MKi67 and suppresses cell growth in the hepatocellular carcinoma cell line QGY-7703.
21478101 2010 Minichromosome maintenance (MCM) and AgNOR proteins expression in desmoid tumours: a tissue microarray analysis.
21435003 2011 Aberrant expression of p53, p16INK4a and Ki-67 as basic biomarker for malignant progression of oral leukoplakias.
21424069 2011 Immunohistochemical nuclear staining for p53, PCNA, Ki-67 and bcl-2 in different histologic variants of basal cell carcinoma.
21422198 2011 Combined RET and Ki-67 assessment in sporadic medullary thyroid carcinoma: a useful tool for patient risk stratification.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21371741 2012 Immunolocalization of PCNA, Ki67, p27 and p57 in normal and dexamethasone-induced intrauterine growth restriction placental development in rat.
21366896 2011 Ki-67 can be used for further classification of triple negative breast cancer into two subtypes with different response and prognosis.
21354936 2011 [Correlation of CerbB-2 to Ki-67 and P53 expressions in hormone-independent breast cancer].
21334717 2011 A prognostic index in skin melanoma through the combination of matrix metalloproteinase-2, Ki67, and p53.
21325804 2011 Enhancer of zeste homologue 2 expression in breast carcinoma smears in relationship with p53, Ki-67 and other prognostic parameters.
21302028 2011 Parametric mapping of immunohistochemically stained tissue sections; a method to quantify the colocalization of tumor markers.
21210727 2011 Expression of the Forkhead transcription factor FOXP1 is associated with tumor grade and Ki67 expression in clear cell renal cell carcinoma.
21111561 2011 Prognostic significance of Ki67 index after neoadjuvant chemotherapy in breast cancer.
21097442 2010 Correlation of Ki-67 and MCM-2 proliferative marker expression with grade of histological malignancy (G) in ductal breast cancers.
21080107 2011 CK5/6, EGFR, Ki-67, cyclin D1, and nm23-H1 protein expressions as predictors of pathological complete response to neoadjuvant chemotherapy in triple-negative breast cancer patients.
21062978 2010 The ability of biomarkers to predict systemic progression in men with high-risk prostate cancer treated surgically is dependent on ERG status.
21058037 2011 CD117, Ki-67, and p53 predict survival in neuroendocrine carcinomas, but not within the subgroup of small cell lung carcinoma.
21045152 2010 Ki-67 as a molecular target for therapy in an in vitro three-dimensional model for ovarian cancer.
20871219 2010 P16/CDKN2A and Ki-67 enhance the detection of anal intraepithelial neoplasia and condyloma and correlate with human papillomavirus detection by polymerase chain reaction.
20868604 2010 [Infection of human papillomavirus 16/18 DNA in patients with head and neck squamous cell carcinoma and its relationship with expression of Ki-67 and P53 protein].
20848772 2010 [Expressions of Ki67, PCNA and mitotic index in ovarian epithelial tumors].
20840814 2010 [Expression of carbonic anhydrase IX in NSCLC and its relationship with VEGF and Ki67 expression].
20819770 2010 Reinke's edema: investigations on the role of MIB-1 and hepatocyte growth factor.
20809021 2010 Immunohistochemical study of p53 and Ki67 in a group of patients with mammary carcinoma.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20800066 2010 Novel application of Ki67 to quantify antigen-specific in vitro lymphoproliferation.
20694513 2011 MCM-2 and MCM-5 expression in gastric adenocarcinoma: clinical significance and comparison with Ki-67 proliferative marker.
20686376 2010 Selected immunohistochemical prognostic factors in endometrial cancer.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20627009 2010 [Relationship between Ki67 expression and tumor response to neoadjuvant chemotherapy with anthracyclines plus taxanes in breast cancer].
20598358 2011 Developmental patterns of Ki-67, bcl-2 and caspase-3 proteins expression in the human upper jaw.
20557372 2010 Micro-anatomical variation in cellular proliferation in endometrial adenocarcinoma, and inverse correlation between Ki67 and cytokeratin 7 expression.
20487522 2010 Aberrant expression of CD133 protein correlates with Ki-67 expression and is a prognostic marker in gastric adenocarcinoma.
20483025 2010 Labeling index in pituitary adenomas evaluated by means of MIB-1: is there a prognostic role? A critical review.
20450760 2010 [Expression of HER2/neu in meningiomas: an immunohistochemistry and fluorescence in situ hybridization study].
20442586 2010 An immunohistochemical comparison of P53 and Bcl-2 as apoptotic and MIB1 as proliferative markers in low-grade and high-grade ovarian serous carcinomas.
20414055 2010 Immunohistochemical overexpression of the p53 protein and Ki-67 (MIB-1) antigen in patients with GERD and chronic esophagitis.
20398247 2010 Ki-67 expression is superior to mitotic count and novel proliferation markers PHH3, MCM4 and mitosin as a prognostic factor in thick cutaneous melanoma.
20381119 2010 CD147 expression in pituitary adenomas and its significance for clinical outcome.
20369584 [Prognostic value of of the expression Ki-67, CD31, and VEGF in somatotropinomas].
20369488 2010 [Expression and significance of P53 and P21 in nasal NK/T-cell lymphoma].
20353905 2010 Human gallbladder carcinoma: Role of neurotrophins, MIB-1, CD34 and CA15-3.
20338617 2010 Nucleophosmin, p53, and Ki-67 expression patterns on an oral squamous cell carcinoma tissue microarray.
20223108 2010 The expression of mismatch repair proteins MLH1, MSH2 and MSH6 correlates with the Ki67 proliferation index and survival in patients with recurrent glioblastoma.
20198771 2009 [The expression of p16(INK4a) and Ki-67 in atrophic-hyperplastic and dysdysplastic lesions of the vulva].
20189840 Impact of the expression of Aurora-A, p53, and MIB-1 on the prognosis of urothelial carcinomas of the upper urinary tract.
20181625 Molecular profiling using tissue microarrays as a tool to identify predictive biomarkers in laryngeal cancer treated with radiotherapy.
20105109 2010 Expression of MASPIN and angiogenin in nasopharyngeal carcinoma: novel preliminary clinico-pathological evidence.
20103726 2010 Assessing efficacy in early-phase cancer prevention clinical trials: the case of ki-67 in the lung.
20103652 2010 SOX9 elevation in the prostate promotes proliferation and cooperates with PTEN loss to drive tumor formation.
20099418 Malignant potential of gastrointestinal stromal tumor of the stomach.
20095356 2009 [Expressions of cyclinB1, FHIT and Ki-67 in 336 gastric carcinoma patients and their clinicopathologic significance].
20082479 2010 Expression of p53, c-erbB-2 and Ki67 in intestinal metaplasia and gastric carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20038236 2010 SUVmax in FDG-PET at the biopsy site correlates with the proliferation potential of tumor cells in non-Hodgkin lymphoma.
20030866 2009 Who would have thought a single Ki67 measurement would predict long-term outcome?
20030864 2009 Who would have thought it! Influence on outcome of radiotherapy, Ki67 and stroma. Introduction to Session 5.
20010526 2009 Correlation between histological type and immunohistochemical profile of prostate cancer and gleason scale gradation.
20001343 2009 Useful immunohistochemical markers for distinguishing Paget cells from Toker cells.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19952937 2010 MIB-1 (Ki-67), estrogen receptor, progesterone receptor, and p53 expression in atypical cells in uterine symplastic leiomyomas.
19946888 2010 Defining the membrane proteome of NK cells.
19946260 2010 Expression of Forkhead-box protein A1, a marker of luminal A type breast cancer, parallels low Oncotype DX 21-gene recurrence scores.
19935641 2010 The prognostic value of Ki67 is dependent on estrogen receptor status and histological grade in premenopausal patients with node-negative breast cancer.
19901884 2009 Correlation of the standardized uptake value in FDG-PET with the expression level of cell-cycle-related molecular biomarkers in resected non-small cell lung cancers.
19854077 CIS is a surrogate marker of genetic instability and field carcinogenesis in the urothelial mucosa.
19832838 2010 Impact of morphology, MIB-1, p53 and MGMT on outcome in pilocytic astrocytomas.
19818763 2010 Minichromosome maintenance protein 3 is a candidate proliferation marker in papillary thyroid carcinoma.
19788614 2009 Characterization of endoglin and Ki-67 expression in endothelial cells from benign and malignant lesions of the uterine cervix.
19777788 2009 Expression of P27, Ki67 and P53 in squamous cell carcinoma, actinic keratosis and Bowen disease.
19774459 2010 Ki67: a time-varying biomarker of risk of breast cancer in atypical hyperplasia.
19773751 2009 Expression of EZH2 and Ki-67 in colorectal cancer and associations with treatment response and prognosis.
19723039 2009 The apoptotic paradox in retinoblastoma.
19690767 2009 Tumor biomarkers in cervical cancer: focus on Ki-67 proliferation factor and E-cadherin expression.
19690760 2009 P53, p63 and Ki-67 assessment in HPV-induced cervical neoplasia.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19687314 2009 Effect of human papillomavirus on cell cycle-related proteins p16, Ki-67, Cyclin D1, p53, and ProEx C in precursor lesions of cervical carcinoma: a tissue microarray study.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19602458 2009 Molecular and immunohistochemical analyses of BCL2, KI-67, and cyclin D1 expression in synovial sarcoma.
19593135 2009 Progress in tailoring adjuvant endocrine therapy for postmenopausal women with early breast cancer.
19585492 2009 Assessment of "grading" with Ki-67 and c-kit immunohistochemical expressions may be a helpful tool in management of patients with flat epithelial atypia (FEA) and columnar cell lesions (CCLs) on core breast biopsy.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19559929 2009 Platelet-derived growth factor expression correlates with tumor grade and proliferative activity in human oligodendrogliomas.
19519606 2009 p16 expression differentiates between desmoplastic Spitz nevus and desmoplastic melanoma.
19470936 2009 MDM2 and Ki-67 predict for distant metastasis and mortality in men treated with radiotherapy and androgen deprivation for prostate cancer: RTOG 92-02.
19462897 2009 [The expression of RhoC and Ki67 in cervical intraepithelial neoplasia and squamous carcinoma of cervix].
19452712 2009 [Expressions of p53 and p21 in nasal NK/T-cell lymphoma and their relationship with the proliferation and apoptosis of cells].
19446313 2010 Steroid receptors, HER2/neu and Ki-67, in endometrioid type of endometrial carcinoma: Correlation with conventional histomorphological features of prognosis.
19436038 2009 Ki67 index, HER2 status, and prognosis of patients with luminal B breast cancer.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19351506 2009 [Expression and significance of hTERT, c-myc and Ki-67 in hepatocellular carcinoma].
19351365 2009 Comparative expression of syndecan-1 and Ki-67 in peripheral and desmoplastic ameloblastomas and ameloblastic carcinoma.
19350669 2009 The role of cytomorphology and proliferative activity in predicting biologic behavior of pancreatic neuroendocrine tumors: a study by endoscopic ultrasound-guided fine-needle aspiration cytology.
19342238 2009 Ki-67 as a prognostic molecular marker in routine clinical use in breast cancer patients.
19340613 2010 Immunohistochemical analysis revealed CD34 and Ki67 protein expression as significant prognostic factors in colorectal cancer.
19291919 2008 Association of Ki67 with raised transaminases in hepatocellular carcinoma.
19220627 2009 Decreased Srcasm expression in hyperproliferative cutaneous lesions.
19207951 2009 Membranous and cytoplasmic staining of Ki67 is associated with HER2 and ER status in invasive breast carcinoma.
19195690 2009 Invasive hydatidiform mole: immunohistochemical labelling of inhibin/activin subunits, Ki67, p53 and glycodelin A in a rare case.
19173807 2008 [Correlation between SUV of (18)F-FDG PET-CT and the expression of GLUT1, MVD and Ki67 in non-small cell lung cancer].
19162366 2009 Prognostic value of KRAS mutations and Ki-67 expression in stage I lung adenocarcinomas.
19160064 2009 Caveolin-1 overexpression correlates with tumour progression markers in pancreatic ductal adenocarcinoma.
19157151 2008 [Expression of epidermal growth factor receptor Ki67 and p16 in human middle ear cholesteatoma].
19152245 2009 Clonal analysis of gastric carcinoma and precancerous lesions and its relation to Ki-67 protein expression.
19144445 2009 Expression of minichromosome maintenance 7 (MCM7) in small lung adenocarcinomas (pT1): Prognostic implication.
19138978 2008 A pilot surrogate endpoint biomarker study of celecoxib in oral premalignant lesions.
19131338 2009 Identification and characterization of a novel nuclear protein complex involved in nuclear hormone receptor-mediated gene regulation.
19130399 2009 Analysis of pRb, p16INK4A proteins and proliferating antigens: PCNA, Ki-67 and MCM5 expression in aggressive fibromatosis (desmoid tumor).
19102938 2008 [Correlation of VEGF and Ki67 expression with sensitivity to neoadjuvant chemoradiation in rectal adenocarcinoma].
19093259 2008 Ki67 and salivary cancer.
19082441 2009 Quantitative molecular grading of bladder tumours: a tool for objective assessment of the biological potential of urothelial neoplasias.
19080002 2008 [Expression and significance of Bmi-1 and Ki67 in colorectal carcinoma tissues].
19077408 2008 Alterations in the peripheral blood lymphocyte CD25 and Ki67 indices in renal cell carcinoma and their significance: a preliminary study.
19050681 2009 Utility of tissue microarrays for profiling prognostic biomarkers in clinically localized prostate cancer: the expression of BCL-2, E-cadherin, Ki-67 and p53 as predictors of biochemical failure after radical prostatectomy with nested control for clinical and pathological risk factors.
19032382 2009 Antigen expression of human eccrine sweat glands.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
19019173 2009 Correlation of chromosomes 1p and 19q status and expressions of O6-methylguanine DNA methyltransferase (MGMT), p53 and Ki-67 in diffuse gliomas of World Health Organization (WHO) grades II and III: a clinicopathological study.
18982746 2008 Breast infiltrating ductal carcinoma: analysis of hormone, HER-2 receptors and Ki-67 proliferation marker.
18949744 Immunohistochemical expression of fatty acid synthase, Ki-67 and p53 in squamous cell carcinomas of the larynx.
18822690 Clinicopathological significance of overexpression of TSPAN1, Ki67 and CD34 in gastric carcinoma.
18798277 2008 A panel of p16(INK4A), MIB1 and p53 proteins can distinguish between the 2 pathways leading to vulvar squamous cell carcinoma.
18798062 2008 Antisense Ki-67 cDNA transfection reverses the tumorigenicity and induces apoptosis in human breast cancer cells.
18778369 2009 Expression levels of apoptosis-related proteins and Ki-67 in nasal NK / T-cell lymphoma.
18766962 2008 Low rather than high Ki-67 protein expression is an adverse prognostic factor in diffuse large B-cell lymphoma.
18766188 2008 Ki-67 expression predicts locoregional recurrence in stage I oral tongue carcinoma.
18762814 2009 Biopsy tissue microarray study of Ki-67 expression in untreated, localized prostate cancer managed by active surveillance.
18727426 [Significance of the expression of nucleolar argyrophilic proteins and antigen Ki-67 in the evaluation of cell proliferative activity and in the prediction of minimal (T1) lung cancer].
18705408 Histopathological parameters with Ki-67 and bcl-2 in the prognosis of meningiomas according to WHO 2000 classification.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18690204 2009 Inhibition of renal cancer cell growth in vitro and in vivo with oncolytic adenovirus armed short hairpin RNA targeting Ki-67 encoding mRNA.
18674924 2008 Ewing's sarcoma of jaw bones in adult patients: 10-year experiences in a Paris university hospital.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18665038 2008 p16, cyclin D1, Ki-67, and AMACR as markers for dysplasia in Barrett esophagus.
18592370 2009 The prognostic significance of Ki67 before and after neoadjuvant chemotherapy in breast cancer.
18572327 2008 Relationship of Ki67, TP53, MDM-2 and BCL-2 expressions with WHO 1973 and WHO/ISUP grades, tumor category and overall patient survival in urothelial tumors of the bladder.
18561741 2008 Expression of p53, bcl-2 and Ki-67 in cervical intraepithelial neoplasia and invasive squamous cell carcinoma of the uterine cervix.
18546942 2007 [Immunohistochemical assessment of molecule Ki67 in nasal polyps tissue].
18516322 2008 Ki-67, p53 and bcl-2 analysis in colonic versus rectal adenocarcinoma.
18510217 2008 [Relevance between clinical behavior and bionomical findings of acoustic neuromas].
18496701 2008 Distribution of dipeptidyl-peptidase IV on keratinocytes in the margin zone of a psoriatic lesion: a comparison with hyperproliferation and aberrant differentiation markers.
18439942 2008 Role of Ki-67 proliferation index and p53 expression in predicting progression of pituitary adenomas.
18374497 2008 The significance of immunohistochemical expression of Ki-67, p53, p21, and p16 in meningiomas tissue arrays.
18331287 2008 Head and neck squamous cell carcinoma in non-smoking and non-drinking patients with multiple tumors: etiologic significance of p53 and Ki-67 in non-tumorous epithelium.
18312749 2008 Ki-67 and PCNA expression in prostate cancer and benign prostatic hyperplasia.
18301453 2006 The role of cyclins and cyclins inhibitors in the multistep process of HPV-associated cervical carcinoma.
18256893 2008 Expression of Ki-67, p53 and p63 proteins in keratocyst odontogenic tumours: an immunohistochemical study.
18234277 2008 Evaluation of estrogen receptor alpha and beta and progesterone receptor expression and correlation with clinicopathologic factors and proliferative marker Ki-67 in breast cancers.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18202755 2008 Expression of p16INK4a and MIB-1 in relation to histopathology and HPV types in cervical adenocarcinoma.
18165175 2007 Intracellular expression of the proliferative marker Ki-67 and viral proteins (NS3, NS5A and C) in chronic, long lasting hepatitis C virus (HCV) infection.
18095132 2007 Analysis of immunohistochemical expression of p53 and the proliferation marker Ki-67 antigen in skull base chordomas: relationships between their expression and prognosis.
18077791 2008 Ki-67 predicts outcome in advanced-stage mantle cell lymphoma patients treated with anti-CD20 immunochemotherapy: results from randomized trials of the European MCL Network and the German Low Grade Lymphoma Study Group.
18038314 2008 Role of fragile histidine triad protein expression in pathogenesis of malignant pleural mesothelioma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18019405 Altered expression of cell cycle regulatory proteins in benign and malignant bone and soft tissue neoplasms.
18018472 2007 MIB-1 immunolabeling: a valuable marker in prediction of benign recurring meningiomas.
18005189 2008 The relationship between tumour proliferative activity, the systemic inflammatory response and survival in patients undergoing curative resection for colorectal cancer.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17972530 Clinical significance of BRAF (V600E) mutation and Ki-67 labeling index in papillary thyroid carcinomas.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17923265 2007 Alteration of cyclin D1 in Chinese patients with breast carcinoma and its correlation with Ki-67, pRb, and p53.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
17885492 2007 The clinical importance of Ki-67, p16, p14, and p57 expression in patients with advanced ovarian carcinoma.
17848143 2007 Non-small cell lung carcinoma: cyclin D1, bcl-2, p53, Ki-67 and HER-2 proteins expression in resected tumors.
17805549 2008 Survivin, p53, and Ki-67 as predictors of histopathologic response in locally advanced rectal cancer treated with preoperative chemoradiotherapy.
17713095 2007 The role of p53, Bcl-2 and Ki-67 in premalignant cervical lesions and cervical cancer.
17695500 Expression of cyclin D1 and Ki-67 in squamous cell carcinoma of the penis.
17693651 2007 Ki-67 expression is predictive of prognosis in patients with stage I/II extranodal NK/T-cell lymphoma, nasal type.
17674766 2007 [Expressions and significances of EGFR, C-erbB2 and Ki-67 in nasal squamous cell carcinomas].
17647192 2007 Expression of proliferation marker Ki67 correlates to occurrence of metastasis and prognosis, histological subtypes and HPV DNA detection in penile carcinomas.
17594714 2007 Ki-67 and coagulative tumor necrosis are independent predictors of poor outcome for patients with clear cell renal cell carcinoma and not surrogates for each other.
17593084 2007 The Ki67+ proliferation index correlates with increased cellular retinol-binding protein-1 and the coordinated loss of plakophilin-1 and desmoplakin during progression of cervical squamous lesions.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17545048 2007 [Association of p16, p53, Ki-67 expressions with high-risk human papilloma virus infection in cervical intraepithelial neoplasia].
17531085 2007 Chromophore-assisted light inactivation of pKi-67 leads to inhibition of ribosomal RNA synthesis.
17525640 2007 Assessment of cell proliferation in benign, premalignant and malignant skin lesions.
17525638 2007 Cell membrane reactivity of MIB-1 antibody to Ki67 in human tumors: fact or artifact?
17525627 2007 The significance of Ki-67 proliferative index and cyclin D1 expression of dysplastic nevi in the biologic spectrum of melanocytic lesions.
17490723 2007 Immunohistochemical study of DNA topoisomerase I, p53, and Ki-67 in uterine carcinosarcomas.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17464313 2007 MIB1 expression in basal cell layer: a diagnostic tool to identify premalignancies of the vulva.
17390041 2007 Correlation of chromosomal imbalances by comparative genomic hybridization and expression of EGFR, PTEN, p53, and MIB-1 in diffuse gliomas.
17377809 2007 Prognostic value of PIK3CA and phosphorylated AKT expression in ovarian cancer.
17310847 2006 Correlation of expression of Ki-67, EGFR, c-erbB-2, MMP-9, p53, bcl-2, CD34 and cell cycle analysis with survival in head and neck squamous cell cancer.
17296585 2007 MUM1 expression dichotomises follicular lymphoma into predominantly, MUM1-negative low-grade and MUM1-positive high-grade subtypes.
17285761 2006 Analysis of p27KIP1 protein and Ki-67 expression in aggressive fibromatosis (desmoid tumor).
17234468 2007 Identification of a basal-like subtype of breast ductal carcinoma in situ.
17227124 2007 Phosphorylated histone H3, Ki-67, p21, fatty acid synthase, and cleaved caspase-3 expression in benign and atypical granular cell tumors.
17225522 2006 [Expression and its significance of STAT3, STAT5, Survivin and Ki67 in nasal NK/T cell lymphoma].
17188136 2006 Patterns of expression of cell cycle/apoptosis genes along the spectrum of thyroid carcinoma progression.
17143016 2007 Ki-67, p53, ER receptors, ploidy and S phase as long-term prognostic factors in T1 node-negative breast cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17065089 2006 Difference in Ki67 and thymidylate synthase expression in primary tumour compared with metastatic nodes in breast cancer patients.
16984615 2006 Usefulness of Ki-67 for predicting the metastatic potential of rectal carcinoids.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16948516 2006 Upper aerodigestive tract squamous dysplasia: correlation with p16, p53, pRb, and Ki-67 expression.
16882345 2006 Prognostic significance of MCM2, Ki-67 and gelsolin in non-small cell lung cancer.
16804724 2006 Prognostic value of cell cycle regulatory proteins in muscle-infiltrating bladder cancer.
16739374 2006 [Prognostic value of Ki67 and VEGF in squamous cell carcinoma of larynx].
16723309 2006 Aromatase and cyclooxygenase-2 expression in endometrial polyps during the menstrual cycle.
16681683 2006 Ki67 immunohistochemistry: a valuable marker in prognostication but with a risk of misclassification: proliferation subgroups formed based on Ki67 immunoreactivity and standardized mitotic index.
16629645 2006 Novel markers of cell kinetics to evaluate progression from cirrhosis to hepatocellular carcinoma.
16623776 2006 Ki67 staining pattern as a diagnostic tool in the evaluation of lymphoproliferative disorders.
16609045 2006 Analysis of c-ErbB1/epidermal growth factor receptor and c-ErbB2/HER-2 expression in bronchial dysplasia: evaluation of potential targets for chemoprevention of lung cancer.
16574316 2007 Immunohistochemical demonstration of proliferating lymphatic vessels in colorectal carcinoma and its clinicopathological significance.
16573167 2006 [Relationship between expression of inducible nitric oxide synthase and proliferative potency of endothelium in hemangioma in infants].
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16533178 2006 Expression of p53, bcl-2, and Ki-67 proteins in the inflammatory regenerative and dysplastic epithelial lesions of flat colonic mucosa.
16479062 2006 Prognostic value of immunohistochemical staining of p53, bcl-2, and Ki-67 in small cell lung cancer.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16351648 2005 The prognostic value of p53, Ki-67 and matrix metalloproteinases MMP-2 and MMP-9 in transitional cell carcinoma of the renal pelvis and ureter.
16295759 2005 [Expression of proliferation marker Ki 67 in chronic lymphocytic leukemia].
16255765 2005 Hepatic expression of the proliferative marker Ki-67 and p53 protein in HBV or HCV cirrhosis in relation to dysplastic liver cell changes and hepatocellular carcinoma.
16244663 2005 Sequential phosphorylation and multisite interactions characterize specific target recognition by the FHA domain of Ki67.
16206250 2006 Ki-67 protein is associated with ribosomal RNA transcription in quiescent and proliferating cells.
16171567 2005 Modulation of Ki-67 expression and morphological changes induced by gef gene in MCF-7 human breast cancer cells.
16097446 p27(kip1) and Ki-67 (MIB1) immunohistochemical expression in radical prostatectomy specimens of patients with clinically localized prostate cancer.
16045773 2005 Ki67 expression in different epithelial types in columnar lined oesophagus indicates varying levels of expanded and aberrant proliferative patterns.
15964376 2005 Ki-67 proliferation index in Kaposi's sarcoma after renal transplantation: findings in skin-only cases versus cases with internal-organ involvement.
15953875 2005 Clinical significance of Ki-67 labeling index in pituitary macroadenoma.
15931389 2005 Microarray analysis identifies a death-from-cancer signature predicting therapy failure in patients with multiple types of cancer.
15896774 2005 In vivo dynamics and kinetics of pKi-67: transition from a mobile to an immobile form at the onset of anaphase.
15871722 2005 Utility of cytokeratin 20 and Ki-67 as markers of urothelial dysplasia.
15809747 2005 Expression of cell proliferating genes in patients with non-small cell lung cancer by immunohistochemistry and cDNA profiling.
15679862 2005 The hTERT-protein and Ki-67 labelling index in recurrent and non-recurrent meningiomas.
15638382 2004 Expression of PCNA and Ki-67 in posterior uveal melanomas in adults.
15638377 2004 Evaluation of proliferating markers Ki-67, PCNA in gastric cancers.
15638357 2004 Intensity of apoptosis as related to the expression of metallothionein (MT), caspase-3 (cas-3) and Ki-67 antigen and the survival time of patients with primary colorectal adenocarcinomas.
15591788 Expression of estrogen receptor-alpha and Ki67 in relation to pathological and molecular features in early-onset infiltrating ductal carcinoma.
15545971 2004 Ki-67 expression and patients survival in lung cancer: systematic review of the literature with meta-analysis.
15452376 2004 Valosin-containing protein (p97) and Ki-67 expression is a useful marker in detecting malignant behavior of pancreatic endocrine neoplasms.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15217948 2004 Ki-67 staining index predicts distant metastasis and survival in locally advanced prostate cancer treated with radiotherapy: an analysis of patients in radiation therapy oncology group protocol 86-10.
15214825 2004 Granular cell tumor: immunohistochemical assessment of inhibin-alpha, protein gene product 9.5, S100 protein, CD68, and Ki-67 proliferative index with clinical correlation.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15104289 2004 Detection of mutations in the cDNA of the proliferation marker Ki-67 protein in four tumor cell lines.
15068320 2004 Prognostic factors in surgical stage I endometrial carcinoma.
15048881 2004 Proliferation marker pKi-67 occurs in different isoforms with various cellular effects.
14707453 2003 Changes in apoptosis and mitotic index, p53 and Ki67 expression in various types of oral leukoplakia.
14674120 2003 [Comparative studies of K1-67 expression between the primary tumor and breast cancer metastases to regional lymph nodes].
14659764 2004 Structure of human Ki67 FHA domain and its binding to a phosphoprotein fragment from hNIFK reveal unique recognition sites and new views to the structural basis of FHA domain functions.
14642363 2004 PTEN gene mutation and high MIB-1 labeling index may contribute to dissemination in patients with glioblastoma.
14627346 2003 Potential role of bcl-2 and ki-67 expression and apoptosis in colorectal carcinoma: a clinicopathologic study.
14582704 2003 34-BetaE12 expression in benign and premalignant squamous lesions of skin: relation to cell proliferation (Ki-67).
12716386 2003 Langerhans cell histiocytosis: an evaluation of histopathological parameters, demonstration of proliferation by Ki-67 and mitotic bodies.
12649825 Retrospective analysis of Ki-67 antigen expression in paraffin tissue blocks of laryngeal squamous cell carcinoma.
12647790 2003 Prognostic significance of metallothionein expression in correlation with Ki-67 expression in adenocarcinomas of large intestine.
12607601 2002 p53 protein and Ki-67 overexpression in urothelial dysplasia of bladder.
12575534 [Morphological, cytogenetic and molecular biological characteristics of lung cancer in persons exposed for a long time to radionuclide radiation pollution in the Semipalatinsk region of Kazakhstan].
12532420 2003 Relationship between E-cadherin gene mutation and p53 gene mutation, p53 accumulation, Bcl-2 expression and Ki-67 staining in diffuse-type gastric carcinoma.
12485163 2002 Interaction of the chromatin compaction-inducing domain (LR domain) of Ki-67 antigen with HP1 proteins.
12479099 2002 [Expressions of CD44s, MMP-9, and Ki-67: possible association with invasion, metastasis, and recurrence of osteosarcoma].
12434121 2002 p53 and Ki-67 expression in epithelial gastric dysplasia and in gastric cancer.
12432453 2002 The proliferation marker pKi-67 becomes masked to MIB-1 staining after expression of its tandem repeats.
12174912 Immunohistochemical analysis of 1,25-dihydroxyvitamin-D3-receptors, estrogen and progesterone receptors and Ki-67 in ovarian carcinoma.
12125971 2002 PCNA and Ki-67 in central nervous system tumors: correlation with the histological type and grade.
12051866 2002 The combined evaluation of p27Kip1 and Ki-67 expression provides independent information on overall survival of ovarian carcinoma patients.
11925591 2002 The abnormal expression of retinoic acid receptor-beta, p 53 and Ki67 protein in normal, premalignant and malignant esophageal tissues.
11857304 2002 p53 and Ki-67 as markers of radioresistance in head and neck carcinoma.
11839580 2002 Breast cancer risk in usual ductal hyperplasia is defined by estrogen receptor-alpha and Ki-67 expression.
11783017 2001 [Abnormal expression of p53, Ki67 and iNOS in human esophageal carcinoma in situ and pre-malignant lesions].
11759064 2001 Tissue microarray technique in soft tissue sarcoma: immunohistochemical Ki-67 expression in malignant fibrous histiocytoma.
11570981 2001 Lack of correlation between Ki-67 labelling index and tumor size of anterior pituitary adenomas.
11342549 2001 A novel nucleolar protein, NIFK, interacts with the forkhead associated domain of Ki-67 antigen in mitosis.
10878551 2000 The biochemical characterization of the DNA binding activity of pKi67.
10878014 2000 The forkhead-associated domain of Ki-67 antigen interacts with the novel kinesin-like protein Hklp2.
10653604 2000 Posttranslational modifications of the KI-67 protein coincide with two major checkpoints during mitosis.
10548634 1999 Immunohistochemical study of the proliferation index, oestrogen receptors and progesterone receptors A and B in leiomyomata and normal myometrium during the menstrual cycle and under gonadotrophin-releasing hormone agonist therapy.
10502411 1999 Biochemical characterization of pKi67 with the identification of a mitotic-specific form associated with hyperphosphorylation and altered DNA binding.
9510506 1998 Association of pKi-67 with satellite DNA of the human genome in early G1 cells.
9087533 1993 Proliferating cell nuclear antigen and Ki-67 antigen expression in human haematopoietic cells during growth stimulation and differentiation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8799815 1996 Localisation of the Ki-67 antigen within the nucleolus. Evidence for a fibrillarin-deficient region of the dense fibrillar component.
8603106 1996 Molecular characterization of the gene locus of the human cell proliferation-associated nuclear protein defined by monoclonal antibody Ki-67.
8227122 1993 The cell proliferation-associated antigen of antibody Ki-67: a very large, ubiquitous nuclear protein with numerous repeated elements, representing a new kind of cell cycle-maintaining proteins.
6339421 1983 Production of a mouse monoclonal antibody reactive with a human nuclear antigen associated with cell proliferation.
6206131 1984 Cell cycle analysis of a cell proliferation-associated human nuclear antigen defined by the monoclonal antibody Ki-67.
2674163 1989 Ki-67 detects a nuclear matrix-associated proliferation-related antigen. I. Intracellular localization during interphase.
2571566 1989 Assignment of the gene(s) involved in the expression of the proliferation-related Ki-67 antigen to human chromosome 10.
2012175 1991 Immunobiochemical and molecular biologic characterization of the cell proliferation-associated nuclear antigen that is defined by monoclonal antibody Ki-67.
1769665 1991 Assignment of the human Ki-67 gene (MK167) to 10q25-qter.