Property Summary

Ligand Count 4
NCBI Gene PubMed Count 135
PubMed Score 236.67
PubTator Score 224.61

Knowledge Summary

Patent (22,043)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.500 1.3e-03
astrocytic glioma -1.700 2.7e-03
Astrocytoma, Pilocytic -1.400 7.3e-08
atypical teratoid / rhabdoid tumor -1.500 1.3e-06
ependymoma -1.600 3.8e-03
glioblastoma -1.600 1.8e-08
group 4 medulloblastoma -1.500 5.9e-06
lung cancer 1.900 8.4e-03
medulloblastoma, large-cell -1.200 9.9e-03
oligodendroglioma -1.200 2.8e-02
ovarian cancer -1.500 5.3e-07
Pick disease -1.700 2.9e-04
primitive neuroectodermal tumor -1.200 1.2e-03
subependymal giant cell astrocytoma -1.458 1.3e-02

Gene RIF (92)

AA Sequence

MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQN      1 - 70
PHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEK     71 - 140
EQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITL    141 - 210
ATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSAS    211 - 280
RQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTK    281 - 350
DESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD                         351 - 399
//

Text Mined References (149)

PMID Year Title