Property Summary

NCBI Gene PubMed Count 128
Grant Count 148
R01 Count 111
Funding $9,320,273.82
PubMed Score 222.65
PubTator Score 224.61

Knowledge Summary

Patent (22,043)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.700 0.003
ependymoma -1.600 0.004
oligodendroglioma -1.300 0.000
glioblastoma -2.100 0.000
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.200 0.001
lung cancer 1.900 0.008
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -1.458 0.013
Pick disease -1.700 0.000
ovarian cancer -1.500 0.000

Synonym

Accession P45985 B2R7N7 B3KYB2 D3DTS5 Q5U0B8 Q6FHX4 Q6P9H2 Q6PIE6 MAP kinase kinase 4
Symbols JNKK
MEK4
MKK4
SEK1
SKK1
JNKK1
SERK1
MAPKK4
PRKMK4
SAPKK1
SAPKK-1

Gene

PDB

3ALN   3ALO   3VUT  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (85)

PMID Text
26554761 the presence of the -1304T > G polymorphism is likely to decrease risk of cancer (Meta-Analysis)
26080319 The plasma level of protein MAP2K4 was found to suggestively associate negatively with the volume of the left entorhinal cortex in asymptomatic older twins.
26028649 MKK4 is activated in vitro by reduced Trx but not oxidized Trx in the absence of an upstream kinase, suggesting that autophosphorylation of this protein occurs due to reduction of Cys-246 and Cys-266 by Trx.
25732927 Data suggest a genetic interaction between MAP2K4 and HLA-DRB1, and the importance of rs10468473 and MAP2K4 splice variants in the development of autoantibody-positive RA.
25244576 knockdown of Sec8 enhances the binding of JIP4 to MAPK kinase 4, thereby decreasing the phosphorylation of MAPK kinase 4, JNK, and p38.
25019290 MAP2K4 increases human prostate cancer metastasis, and prolonged over expression induces long term changes in cell signaling pathways leading to independence from p38 MAPK and JNK.
24721794 Demonstrate that Mkk4 is a negative regulator of the TGF-beta1 signaling associated with atrial remodeling and arrhythmogenesis with age.
24556602 MicroRNA-27a promotes proliferation, migration and invasion by targeting MAP2K4 in human osteosarcoma cells.
24532253 Lipopolysaccharide induced miR-181a promotes pancreatic cancer cell migration via targeting PTEN and MAP2K4.
23960075 Arrestin-3 directly interacts with MKK7 and promotes JNK3alpha2 phosphorylation by both MKK4 and MKK7 in vitro as well as in intact cells.
More...

AA Sequence

MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQN      1 - 70
PHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEK     71 - 140
EQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITL    141 - 210
ATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSAS    211 - 280
RQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTK    281 - 350
DESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD                         351 - 399
//

Text Mined References (142)

PMID Year Title
26554761 2015 Mitogen-Activated Protein Kinase Kinase 4 Gene Polymorphism and Cancer Risk.
26080319 2015 Plasma protein biomarkers of Alzheimer's disease endophenotypes in asymptomatic older twins: early cognitive decline and regional brain volumes.
26028649 2015 Thioredoxin Activates MKK4-NF?B Pathway in a Redox-dependent Manner to Control Manganese Superoxide Dismutase Gene Expression in Endothelial Cells.
25732927 2015 Gene-gene interaction and RNA splicing profiles of MAP2K4 gene in rheumatoid arthritis.
25244576 2014 Knockdown of Sec8 enhances the binding affinity of c-Jun N-terminal kinase (JNK)-interacting protein 4 for mitogen-activated protein kinase kinase 4 (MKK4) and suppresses the phosphorylation of MKK4, p38, and JNK, thereby inhibiting apoptosis.
25019290 2014 Mitogen-activated protein kinase kinase 4 (MAP2K4) promotes human prostate cancer metastasis.
24721794 2014 Mkk4 is a negative regulator of the transforming growth factor beta 1 signaling associated with atrial remodeling and arrhythmogenesis with age.
24556602 2014 MicroRNA-27a promotes proliferation, migration and invasion by targeting MAP2K4 in human osteosarcoma cells.
24532253 2014 LPS induced miR-181a promotes pancreatic cancer cell migration via targeting PTEN and MAP2K4.
24487067 2014 Map2k4? - identification and functional characterization of a novel Map2k4 splice variant.
More...