Property Summary

Ligand Count 256
NCBI Gene PubMed Count 739
PubMed Score 5770.78
PubTator Score 2545.41

Knowledge Summary

Patent (203,280)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (13)

Disease log2 FC p
acute myeloid leukemia 2.000 4.8e-02
adult high grade glioma -1.200 2.9e-03
Astrocytoma, Pilocytic -1.100 1.2e-04
atypical teratoid / rhabdoid tumor -1.100 4.7e-05
Breast cancer -1.200 1.7e-12
ependymoma -1.100 2.6e-08
glioblastoma -1.300 1.4e-08
group 4 medulloblastoma 1.900 2.6e-04
intraductal papillary-mucinous carcinoma... 1.100 7.3e-03
osteosarcoma 1.081 5.6e-04
ovarian cancer 1.200 5.0e-08
spina bifida -1.412 3.7e-02
tuberculosis -1.200 4.1e-05

Protein-protein Interaction (6)

Gene RIF (650)

AA Sequence

MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQTHAKRA      1 - 70
YRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQMELDHERMSYLLYQMLCGIK     71 - 140
HLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDLWS    141 - 210
VGCIMGEMVCHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLF    211 - 280
PADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIE    281 - 350
EWKELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA    351 - 420
GPLGCCR                                                                   421 - 427
//

Text Mined References (752)

PMID Year Title