Property Summary

Ligand Count 1
NCBI Gene PubMed Count 35
PubMed Score 166.07
PubTator Score 36.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.7e-04
diabetes mellitus 1728 1.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 1.1e-03
medulloblastoma, large-cell 1.100 1.7e-04

Gene RIF (14)

AA Sequence

MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTGQRVY      1 - 70
LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLP     71 - 140
DIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWL    141 - 210
NLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFG    211 - 280
IDMLKMQKTDKTMTELEIDMNQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDF    281 - 350
QRKYVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL    351 - 420
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYTQRVDYIMQLP    421 - 490
VPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPEQVDDFWSTALQAKSVAVKTT    491 - 560
RFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEEELPDIAPPLVTPDEPKGS    561 - 630
LGFYGNEDEDSFCSPHFSSPTSPMLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPD    631 - 700
FANPLILPGSSGPGSTSAAADPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEA    701 - 770
AMDISEGRSAADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS    771 - 840
EKPPKDLGYIYFYQRVAS                                                        841 - 858
//

Text Mined References (46)

PMID Year Title