Property Summary

NCBI Gene PubMed Count 33
Grant Count 25
R01 Count 18
Funding $2,228,431.87
PubMed Score 153.10
PubTator Score 36.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.000
diabetes mellitus -1.100 0.001

Gene RIF (12)

PMID Text
25970461 Charge-state distribution and ion mobility analysis revealed that both mono- and tetra-ubiquitin bound to the compact conformation of USP5 only.
25641936 Used IM-MS analysis to study conformational flexibility of the multidomain deubiquitinating enzyme ubiquitin specific protease 5 (USP5).
25207809 A ubiquitin shuttle DC-UbP reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
24454762 polyubiquitin chains by USP5 at sites of damage is important for efficient DSB repair
23720098 Cellular isopeptidase T deubiquitinating enzyme disassembles free ubiquitin chains to facilitate KSHV K7 degradation.
23375434 Local administration of NO may prevent neointimal hyperplasia by inhibiting isopeptidase T levels and activity in the vasculature, thereby inhibiting the 26S proteasome in vascular smooth muscle cells.
22283393 USP5 uses multiple zinc fluoride (ZnF)-ubiquitin binding protein (UBP) domains for substrate targeting and core catalytic function.
21976412 Production of the USP5 isoform 2 was strongly correlated with PTBP1 expression in glioblastoma tumor samples and cell lines.
19098288 p53 is selectively stabilized because the unanchored polyubiquitin that accumulates after USP5 knockdown is able to compete with ubiquitinated p53 but not with Mdm2 for proteasomal recognition
16564012 We report the crystal structures of the zinc-finger ubiquitin binding domain (ZnF UBP) from the deubiquitinating enzyme isopeptidase T (IsoT, or USP5) alone and in complex with ubiquitin. This domain is required for optimal catalytic activation of IsoT.
More...

AA Sequence

MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVERHFNKTGQRVY      1 - 70
LHLRRTRRPKEEDPATGTGDPPRKKPTRLAIGVEGGFDLSEEKFELDEDVKIVILPDYLEIARDGLGGLP     71 - 140
DIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWL    141 - 210
NLTDGSILCGRRYFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDEDDMVLDPSLAEHLSHFG    211 - 280
IDMLKMQKTDKTMTELEIDMNQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDF    281 - 350
QRKYVDKLEKIFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPVPESGDGERVPEQKEVQDGIAPRMFKAL    351 - 420
IGKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYTQRVDYIMQLP    421 - 490
VPMDAALNKEELLEYEEKKRQAEEEKMALPELVRAQVPFSSCLEAYGAPEQVDDFWSTALQAKSVAVKTT    491 - 560
RFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQLRGTGLQPGEEELPDIAPPLVTPDEPKGS    561 - 630
LGFYGNEDEDSFCSPHFSSPTSPMLDESVIIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPD    631 - 700
FANPLILPGSSGPGSTSAAADPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEA    701 - 770
AMDISEGRSAADSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCAS    771 - 840
EKPPKDLGYIYFYQRVAS                                                        841 - 858
//

Text Mined References (44)

PMID Year Title
25970461 2015 Structural insights into interactions between ubiquitin specific protease 5 and its polyubiquitin substrates by mass spectrometry and ion mobility spectrometry.
25641936 2015 Ion mobility-mass spectrometry reveals conformational flexibility in the deubiquitinating enzyme USP5.
25416956 2014 A proteome-scale map of the human interactome network.
25207809 2014 A ubiquitin shuttle DC-UbP/UBTD2 reconciles protein ubiquitination and deubiquitination via linking UbE1 and USP5 enzymes.
24454762 2014 Ubiquitin-specific protease 5 is required for the efficient repair of DNA double-strand breaks.
24424410 2014 USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720098 2015 The cellular isopeptidase T deubiquitinating enzyme regulates Kaposi's sarcoma-associated herpesvirus K7 degradation.
23375434 2013 Nitric oxide may inhibit neointimal hyperplasia by decreasing isopeptidase T levels and activity in the vasculature.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...