Property Summary

NCBI Gene PubMed Count 136
PubMed Score 83.41
PubTator Score 390.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
acute myeloid leukemia 1.400 1.5e-02
adrenocortical carcinoma 1.309 3.7e-03
Alzheimer's disease 1.100 4.3e-02
astrocytic glioma 1.100 4.9e-02
atypical teratoid / rhabdoid tumor 2.200 4.8e-06
cystic fibrosis -1.100 4.9e-03
ependymoma 1.100 1.8e-02
glioblastoma 1.500 3.3e-04
group 3 medulloblastoma 1.200 4.3e-02
lung adenocarcinoma 1.100 1.3e-06
lung carcinoma 1.100 6.3e-21
medulloblastoma, large-cell 1.500 5.5e-05
oligodendroglioma 1.700 3.9e-03
osteosarcoma 1.349 1.5e-02
ovarian cancer -1.400 8.5e-05
pediatric high grade glioma 1.200 1.4e-03
permanent atrial fibrillation -1.200 1.5e-02
Pick disease 1.600 3.5e-05
primitive neuroectodermal tumor 1.700 4.1e-04
Rheumatoid arthritis 1.300 1.1e-02
sarcoidosis 1.200 1.9e-02

Gene RIF (80)

AA Sequence

MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKY      1 - 70
KKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLM     71 - 140
KWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS                       141 - 191
//

Text Mined References (155)

PMID Year Title