Property Summary

NCBI Gene PubMed Count 125
Grant Count 28
R01 Count 13
Funding $3,026,131.65
PubMed Score 80.61
PubTator Score 390.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.011
astrocytic glioma 1.100 0.049
ependymoma 1.800 0.000
oligodendroglioma 1.800 0.010
permanent atrial fibrillation -1.200 0.015
osteosarcoma 2.065 0.000
atypical teratoid / rhabdoid tumor 2.200 0.000
glioblastoma 1.500 0.000
group 3 medulloblastoma 1.400 0.001
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.700 0.000
adrenocortical carcinoma 1.378 0.001
sarcoidosis 1.200 0.019
cystic fibrosis -1.100 0.005
pediatric high grade glioma 1.200 0.001
acute myeloid leukemia 1.400 0.015
lung adenocarcinoma 1.100 0.000
lung carcinoma 1.100 0.000
Alzheimer's disease 1.100 0.043
Pick disease 1.600 0.000
ovarian cancer 2.000 0.000

Gene RIF (73)

PMID Text
26791953 We demonstrate that an hnRNPA1 and CBX5 bi-directional core promoter fragment does not comprise intrinsic capacity for specific CBX5 down-regulation in metastatic cells
26157143 PIP5K1A modulates ribosomal RNA gene silencing through its interaction with histone H3 lysine 9 trimethylation and heterochromatin protein HP1-alpha.
25960296 Identify a nuclear localization signal within the 462-494 amino acid region of TRIM28 that overlaps with its HP1 binding site. GST-pulldown experiments revealed the interaction of the arginine-rich TRIM28 NLS with various importin alpha subtypes.
25945750 Jra recruits the HP1a/KDM4A complex to its gene body region upon osmotic stress to reduce H3K36 methylation levels and disrupt H3K36 methylation-dependent histone deacetylation
25934638 a considerable number of alternative splicing events could have a chromatin-dependent regulation involving the association of HP1alpha and CTCF near regulated exons.
25818296 SET interacts with the Kruppel-associated box (KRAB)-associated co-repressor KAP1, and its overexpression results in the sustained retention of KAP1 and Heterochromatin protein 1 (HP1) on chromatin
25704815 HP1 regulates this gene's alternative splicing in a methylation-dependent manner by recruiting splicing factors to its methylated form.
25588582 HP1alpha plays an important role in the differentiation and angiogenic function of Endothelial Progenitor Cells.
25519718 Paternal heterochromatin formation in human embryos is H3K9/HP1 directed and primed by sperm-derived histone modifications.
25384975 RAD6 physically interacts with heterochromatin protein 1alpha and ubiquitinates HP1alpha at residue K154, thereby promoting heterochromatin protein 1alpha degradation through the autophagy pathway
More...

AA Sequence

MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKY      1 - 70
KKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLM     71 - 140
KWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS                       141 - 191
//

Text Mined References (141)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26791953 2016 Regulatory dissection of the CBX5 and hnRNPA1 bi-directional promoter in human breast cancer cells reveals novel transcript variants differentially associated with HP1? down-regulation in metastatic cells.
26157143 2015 Phosphatidylinositol-4-phosphate 5-Kinase 1? Modulates Ribosomal RNA Gene Silencing through Its Interaction with Histone H3 Lysine 9 Trimethylation and Heterochromatin Protein HP1-?.
25960296 2015 Identification and characterization of a nuclear localization signal of TRIM28 that overlaps with the HP1 box.
25945750 2015 HP1a/KDM4A is involved in the autoregulatory loop of the oncogene gene c-Jun.
25934638 2015 A chromatin code for alternative splicing involving a putative association between CTCF and HP1? proteins.
25818296 2015 The nuclear oncogene SET controls DNA repair by KAP1 and HP1 retention to chromatin.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25704815 2015 HP1 is involved in regulating the global impact of DNA methylation on alternative splicing.
More...