Property Summary

NCBI Gene PubMed Count 22
PubMed Score 21.26
PubTator Score 23.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.523 4.6e-04
adult high grade glioma -1.600 1.1e-06
atypical teratoid / rhabdoid tumor -1.300 6.3e-07
Breast cancer -1.200 3.5e-03
ependymoma -1.400 3.7e-02
glioblastoma -1.200 6.8e-06
interstitial cystitis -1.100 5.4e-04
malignant mesothelioma -1.700 2.3e-06
medulloblastoma, large-cell -1.500 1.8e-04
non-small cell lung cancer -1.051 5.9e-10
pancreatic ductal adenocarcinoma liver m... -3.318 6.0e-03
Pick disease -1.400 5.9e-05
progressive supranuclear palsy -1.300 2.0e-02
ulcerative colitis -1.100 1.0e-03

Protein-protein Interaction (1)

Gene RIF (12)

AA Sequence

MEGLAVRLLRGSRLLRRNFLTCLSSWKIPPHVSKSSQSEALLNITNNGIHFAPLQTFTDEEMMIKSSVKK      1 - 70
FAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKVDASVAVFCE     71 - 140
IQNTLINTLIRKHGTEEQKATYLPQLTTEKVGSFCLSEAGAGSDSFALKTRADKEGDYYVLNGSKMWISS    141 - 210
AEHAGLFLVMANVDPTIGYKGITSFLVDRDTPGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGQIG    211 - 280
HGYKYAIGSLNEGRIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQGLQHQVAHVATQLEAARLLT    281 - 350
YNAARLLEAGKPFIKEASMAKYYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQ    351 - 420
LNTIAKHIDAEY                                                              421 - 432
//

Text Mined References (29)

PMID Year Title