Property Summary

NCBI Gene PubMed Count 49
Grant Count 42
R01 Count 29
Funding $4,495,695.63
PubMed Score 72.15
PubTator Score 45.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (25)

PMID Text
26947058 The works available on VDAC cysteines support the notion that VDAC1, VDAC2, and VDAC3 proteins are paralogs with a similar pore-function and slightly different, but important, ancillary biological functions. (Review)
26487717 The evolutionary demand for the NTE in the presence of cysteines clearly emerges from our biochemical and functional studies, providing insight into factors that functionally demarcate hVDAC-2 from the other VDACs.
26417093 Motifs of VDAC2 required for mitochondrial Bak import and tBid-induced apoptosis.
25617717 Results show that in thyroid tumours and cell lines, VDAC2 is upregulated and BAK1 downregulated. Also, transient knockdown of VDAC2 promoted upregulation of the BAK1 expression, and increased susceptibility to sorafenib treatment.
25583988 RACK1 plays an antiapoptotic role during IBDV infection via interaction with VDAC2 and VP5.
25341036 These data suggest that an interaction between Mcl-1 and VDAC promotes lung cancer cell migration by a mechanism that involves Ca(2+)-dependent reactive oxygen species production.
25187518 GSK-3beta translocates from the cytosol to mitochondria in a kinase activity- and VDAC2-dependent manner in which an N-terminal domain of GSK-3beta may function as a mitochondrial targeting sequence
24642864 Cysteine residues impact the stability and micelle interaction dynamics of the human mitochondrial beta-barrel anion channel VDAC-2.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of voltage-dependent anion channel 2 (VDAC2) expression by HIV-1 Vpr in Vpr transduced macrophages
23873934 minor conformational variations in local residues are sufficient to define the membrane protein dynamics in hVDAC-2.
More...

AA Sequence

MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLE      1 - 70
TKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDV     71 - 140
DFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVC    141 - 210
EDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSIN    211 - 280
AGGHKVGLALELEA                                                            281 - 294
//

Text Mined References (61)

PMID Year Title
26947058 2016 Role of cysteines in mammalian VDAC isoforms' function.
26487717 2015 N-helix and Cysteines Inter-regulate Human Mitochondrial VDAC-2 Function and Biochemistry.
26417093 2015 Motifs of VDAC2 required for mitochondrial Bak import and tBid-induced apoptosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25617717 2015 The proteomic 2D-DIGE approach reveals the protein voltage-dependent anion channel 2 as a potential therapeutic target in epithelial thyroid tumours.
25583988 2015 The association of receptor of activated protein kinase C 1(RACK1) with infectious bursal disease virus viral protein VP5 and voltage-dependent anion channel 2 (VDAC2) inhibits apoptosis and enhances viral replication.
25341036 2014 Mcl-1 promotes lung cancer cell migration by directly interacting with VDAC to increase mitochondrial Ca2+ uptake and reactive oxygen species generation.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25187518 2014 Translocation of glycogen synthase kinase-3? (GSK-3?), a trigger of permeability transition, is kinase activity-dependent and mediated by interaction with voltage-dependent anion channel 2 (VDAC2).
More...