Property Summary

NCBI Gene PubMed Count 18
PubMed Score 44.93
PubTator Score 14.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.012 2.2e-02
adult high grade glioma 1.700 1.4e-03
atypical teratoid / rhabdoid tumor 1.900 1.1e-03
ependymoma 2.100 1.1e-06
glioblastoma 1.400 7.3e-04
intraductal papillary-mucinous neoplasm ... 1.200 3.0e-02
lung adenocarcinoma 1.205 7.8e-09
lung carcinoma -1.700 1.0e-29
osteosarcoma 3.038 2.1e-04
ovarian cancer 1.700 1.2e-02
pancreatic cancer 1.100 4.5e-03
Pick disease 1.100 7.4e-03
pituitary cancer -1.800 7.2e-05
primary pancreatic ductal adenocarcinoma 1.009 2.6e-03
subependymal giant cell astrocytoma 2.623 1.2e-02

Gene RIF (3)

AA Sequence

MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENF      1 - 70
VALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPD     71 - 140
TNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA    141 - 210
DW                                                                        211 - 212
//

Text Mined References (18)

PMID Year Title