Property Summary

NCBI Gene PubMed Count 17
PubMed Score 40.01
PubTator Score 14.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Stomach Neoplasms 282
Disease Target Count P-value
lung carcinoma 2844 1.00205576296955E-29
posterior fossa group A ependymoma 1511 4.25500770291638E-17
glioblastoma multiforme 347 6.67418685833961E-17
lung adenocarcinoma 2714 7.76439333477132E-9
pituitary cancer 1972 7.23588268820053E-5
osteosarcoma 7933 2.05032942901285E-4
atypical teratoid / rhabdoid tumor 4369 0.00111013787821848
adult high grade glioma 2148 0.00143598428064103
primary pancreatic ductal adenocarcinoma 1271 0.00264951528549179
pancreatic cancer 2300 0.00454822698352184
Pick disease 1893 0.00735344131900807
subependymal giant cell astrocytoma 2287 0.011519437814028
ovarian cancer 8492 0.0124176232406061
active Crohn's disease 918 0.0218375962833488
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0296455468580315
Disease Target Count Z-score Confidence
Food allergy 8 4.477 2.2
Disseminated intravascular coagulation 32 3.339 1.7

Expression

Synonym

Accession P45877 A4LBB5 PPIase C
Symbols CYPC

Gene

PANTHER Protein Class (1)

PDB

2ESL  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (2)

PMID Text
26691022 Cyclophilin C participates in cytomegalovirus US2 protein-mediated degradation of major histocompatibility complex class I molecules.
24990953 These findings establish cyclophilin C as an ER cyclophilin, demonstrate the novel involvement of cyclophilins B and C in ER redox homeostasis

AA Sequence

MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENF      1 - 70
VALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPD     71 - 140
TNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIA    141 - 210
DW                                                                        211 - 212
//

Text Mined References (17)

PMID Year Title
26691022 2015 Cyclophilin C Participates in the US2-Mediated Degradation of Major Histocompatibility Complex Class I Molecules.
25416956 2014 A proteome-scale map of the human interactome network.
24990953 2014 Depletion of cyclophilins B and C leads to dysregulation of endoplasmic reticulum redox homeostasis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...